KEGG   Mizuhopecten yessoensis (Yesso scallop): 110450709Help
Entry
110450709         CDS       T05079                                 

Definition
(RefSeq) histone deacetylase 8-like
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:myi03036]
    110450709
Enzymes [BR:myi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110450709
Chromosome and associated proteins [BR:myi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110450709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110450709
NCBI-ProteinID: XP_021354045
LinkDB All DBs
Position
Unknown
AA seq 616 aa AA seqDB search
MDIGRPAKRVRSDPDVGPSSSDWLASAAAEGQEIVQCTMLSGDGHCPSSRNMSVVTTPIE
TSHTNVANLGNPENYQVKSEDEKIINSCNISQMEKSTGKDKETDIVTPSIGNWDGSANDT
EQKREHFDKGDNVSPADLPVAVESDHGIQVKSVYDLEMEEDYKEVTVQSLQSLRTAKRDN
KENVINKNGLVLLSEKVQDDVASGLTNISEKVKESGTDTCVSSKSNINKDASKESPVPVP
AQVTMSNKTKLQRRVSYVYSKELIQECNLMQKIPNRAGMVHSLIEAYGILKYMRVIDPSK
ATEESLCLFHSPEYIEFLKKINDQEDEEIYDEEAAQFGLTYDCPVHQGVFDYALSVGGAT
VSAAEELIRRQCDVAINWCGGWHHAQKDSASGFCYVNDIVLGILKLREKFSRVLYVDLDL
HHGDGVQNAFYATSAVMTVSIHKYAAGFFPGSGQLEDIGIGKGKKYSINIPLQDGARDQE
FVALFCRVIQKVRTVFRPEAIVCQCGADGLVGDPMDSFNLTPLSLGRCVYFLLDWALPTL
LLGGGGYHHTNTARCWTFLTSVAVGKKLPSDIPDHQYFMEYGPDYGIDISAGNRKDQNSQ
EYLRKVHRYIIDILSH
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggatataggacgaccagcaaagagagtccgctcagatccagacgtcggtcccagtagc
tctgattggctggcatcagccgcggcagagggtcaagaaattgttcaatgtacgatgtta
tctggtgatggtcattgtccgtccagtagaaacatgtctgtcgtaactacccctattgaa
acaagtcataccaatgtagcaaaccttggtaacccagaaaattatcaggtgaaatctgag
gatgaaaagataataaacagttgtaatatttcacagatggagaaatctactggtaaagat
aaagaaacagatattgttacaccttctataggtaactgggatggctctgctaatgataca
gaacagaaaagggaacattttgataaaggtgacaatgtctcacctgcagatttacctgta
gcagtagaaagtgaccacggtatacaggtaaagagtgtgtatgaccttgaaatggaggaa
gattataaggaagtaactgttcagtcattacaaagtttgaggaccgcaaagagggacaac
aaagaaaatgtgatcaataaaaacggtcttgtgcttttatcagagaaggtgcaagatgat
gttgctagtggattaactaatatttcagaaaaggtaaaggaaagtggaacagatacatgt
gttagttctaagtcaaacataaataaggatgcttctaaggaatcaccagtaccagtacct
gcacaggttaccatgagcaacaaaacaaagcttcaacgaagggtgtcctatgtgtatagt
aaagagttgattcaggaatgtaacctcatgcaaaagattcctaacagggcaggcatggtg
cacagtctgattgaagcttatggaatactcaaatatatgagagttattgacccttccaaa
gcgacagaagaatcactttgtctgtttcattcccccgaatatatagaatttctgaagaaa
atcaatgatcaggaggatgaagaaatctacgatgaagaagcggcacagtttggcctgacc
tatgactgtcctgtccatcagggcgtgtttgactacgccctgtctgtgggaggagccacc
gtctctgcagcagaggaattgatccgcaggcagtgtgatgtggccattaattggtgtggt
ggatggcatcatgctcaaaaggacagcgcatcgggtttctgttatgtcaatgacatcgtc
cttgggatactcaagctacgagagaagttctccagggtgctgtatgtcgatttggaccta
caccatggagatggtgtacagaatgctttctatgccacatcagcagtaatgacggtctcc
atacacaaatatgctgctggattcttcccaggttcaggacagctagaagatattggaatt
ggcaagggcaagaaatattctatcaacatcccgctacaagatggtgctagggaccaggag
tttgtcgctttgttttgcagggtgatacagaaggtgcgcactgtgttcagacctgaggcg
atagtttgtcagtgtggggcggatggtttggttggtgatcctatggactctttcaacctc
actccgctgtcgttaggccgctgtgtgtacttcctgttagactgggcactccccacactt
ctgctgggaggaggtggctaccatcacacaaacacagccaggtgctggacctttctgaca
agtgtagctgtcggtaaaaaactgccatcagatatacctgatcatcagtatttcatggag
tatggaccagactatggaattgacatttcggctggtaacaggaaggaccaaaactcacag
gaatacttacggaaagtccatcggtacattattgatatattatcgcactga

DBGET integrated database retrieval system