KEGG   Mizuhopecten yessoensis (Yesso scallop): 110450908Help
Entry
110450908         CDS       T05079                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00020  Citrate cycle (TCA cycle)
myi00190  Oxidative phosphorylation
myi01100  Metabolic pathways
myi01200  Carbon metabolism
Module
myi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
myi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110450908
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110450908
Enzymes [BR:myi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110450908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 110450908
NCBI-ProteinID: XP_021354377
LinkDB All DBs
Position
Unknown
AA seq 666 aa AA seqDB search
MASVLKLTSQSAHRAVLKNVLRVSPAIGSSQRNLHFNIQGRNSDATSSTGQSLSRKYPVI
DHTYDAVVVGAGGAGLRAAFGLANEGFKTACITKLFPTRSHTVAAQGGINAALGHMEEDS
WKYHFYDTVKGSDWLGDQDAIQYMCEEAPKAVIELENYGMPFSRLENGKIYQRAFGGQSL
KYGKGGQAHRCCCVADRTGHSLLHTLYGRSLKYDTHYFIEYFALDLIMEDGECRGVIALC
LEDGTIHRFRSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVTRAGLPNEDMEFVQFHPT
GIYGAGCLITEGSRGEGGILVNSEGERYMERYAPTAKDLASRDVVSRSSTIEIREGRGVG
PDKDHVYLQLSHLDPEVLKARLPGISETAMIFAGVDVTRDPIPVLPTVHYNMGGVPTNYK
GQAIHVKNGEDVVIQGLYACGEAACASVHGANRLGANSLLDLVVFGRACANTIKEENRPG
EAIGNIKDNAGEESIANLDKLRHANGSTPTADLRLKMQKVMQNNAAVFRDGPILKEGVEK
MDVLFKEMEDIKVSDRGMVWNTDLVETLELQNLMLNGMQTIVSAEARKESRGAHAREDFK
DRIDEYDYSKDVSGQTAKPFSEHWRKHTMSYQDHNTGKVTLEYRGVIDDTLDKDKCETIP
PAIRSY
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgtgttgaagttgacctctcaatcagctcatagagctgtattgaaaaatgtt
ttgagagtttcaccagccataggctcaagtcagagaaaccttcacttcaacatacagggt
cgtaacagtgatgcaacatcatcaacaggacaatcgctgtcgaggaagtatcctgtgata
gaccacacctacgatgctgtagtggttggagcagggggcgctggtctccgagccgccttt
ggcctggctaatgaaggcttcaaaacagcatgtatcacaaaactcttccctaccagatca
cacacagtggccgctcagggcggtatcaatgctgcactaggacatatggaggaagattcg
tggaagtaccacttctacgacaccgtgaagggatctgattggttgggggaccaagacgcc
attcagtacatgtgtgaggaagcccctaaagccgtcattgagctggaaaattatggcatg
cccttcagtcgacttgaaaatgggaagatataccagagagcttttggtggtcagagttta
aagtatggtaaaggtggacaggcccacaggtgttgctgtgtagctgaccgcaccggtcac
tccctcctccacacactgtatggacggtcactcaaatatgatacacattacttcattgaa
tacttcgctttggatctgatcatggaggacggagagtgccgaggagttatagccctttgt
ctcgaagatggtaccatacatagatttagatccaagaacacagtgttggctacaggtggt
tacggtcgtgcttacttctcctgtacatcagcacacacctgtactggtgacggtactgcc
atggttaccagagctggactccctaacgaggatatggagtttgtacagttccatcctaca
ggtatatacggtgctggctgtctcatcacggaaggttcccgaggcgagggaggaattctg
gtaaactctgaaggcgagagatacatggagcgctatgcaccgacggctaaagatctggct
tctcgtgatgtcgtgtcacgatcaagcactattgaaattagagaaggaagaggggtgggg
ccagacaaagatcatgtgtatctgcaactgtcacatctggatcctgaggtgctgaaagct
agacttccaggtatttctgagacagccatgatcttcgccggagttgatgtgacaagagat
cccattccagtccttcccactgtccattacaatatgggcggagtacccacaaactacaaa
ggacaggcgatacatgtgaagaatggtgaagatgtggtgatccaaggtctatatgcttgt
ggagaagcagcttgcgcttccgttcacggggccaaccgtcttggtgcaaactccctcctc
gatctggtcgtctttggccgtgcatgcgccaacaccatcaaggaagagaatcgaccaggc
gaagccattggtaacataaaagataacgctggagaggaatcgatagccaacttagacaag
ctcagacacgccaatggaagtacacctacagctgacctgaggcttaagatgcaaaaggtg
atgcagaacaacgctgctgtgttccgtgatggccccatccttaaggaaggagtggagaaa
atggatgttctctttaaagaaatggaagacatcaaggtgtcagaccgtggtatggtgtgg
aatactgacctggtcgagaccctggagctacagaatctgatgctgaatggtatgcagacc
attgtctctgcagaggcaaggaaagaaagccggggagctcatgctagagaagacttcaag
gatagaattgatgagtacgactatagtaaggatgtgtccggacagaccgcgaaacctttc
agcgaacattggaggaaacacaccatgtcttaccaagaccataacaccggaaaggtcaca
ctggaatacagaggtgtcattgatgatactttggacaaagacaagtgtgaaacgattcca
ccagcaattcgttcttattag

DBGET integrated database retrieval system