KEGG   Mizuhopecten yessoensis (Yesso scallop): 110451334Help
Entry
110451334         CDS       T05079                                 

Definition
(RefSeq) procollagen galactosyltransferase 1-like isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00310  Lysine degradation
myi00514  Other types of O-glycan biosynthesis
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110451334
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    110451334
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:myi01003]
    110451334
Enzymes [BR:myi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     110451334
Glycosyltransferases [BR:myi01003]
 O-Glycan biosynthesis
  O-linked Gal type
   110451334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 110451334
NCBI-ProteinID: XP_021354955
LinkDB All DBs
Position
Unknown
AA seq 606 aa AA seqDB search
MLLEMAGNQLTCRQTILFYLMFCLAVSSSAKEADENDDTDDEPEYNQPTVMIAILVRNKE
HVLPWFLEYLDKLKYPKKRITLWIRSDHNKDDSVRMLKQWLAAVKDQYHSVDVQYQYDQE
YADERGPCDWSNERFTNVMKLRQAALDNARKIWADYLFMIDADVVLENPQTLTLLMNEER
AIVAPMLNASVGDTYSNFWGGMTDGGYYSRSDDYFDMVGRKLTGCFKVPMVHSAFLINMH
HLLTEKIAYNPAPENYNGPYDDIIIFAYSVKAAGLSMYVLNTEYFGKVMIPLDYYNTLRD
ESDHFTFIKLETMDADFIYEELGDRQYPVKRPPLRRSPYIDVEDPVADKMMFDEIYMINL
VRRPERRQRMMEALKELGIQVTIFDAVDGRQLNNTYLDKLGVEMMDGYADPYAGRSLTMG
EIGCFLSHFFIWKEILDKGYKSTLVLEDDVRFEPYFRTKLMRLLQEVEDRIPDWDLLYLG
RKRLKISEESYVEGSETLVWPSYSYWTLSYILSNRGAKKLLQQEPLSKMIPVDEYLPIMF
DKHPEGKWKEQFSPRDIVGLSAYPFLVYPTHYTGEQSYFSDTEDSVTILGEVNSEAVNLH
NKKDEL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgttgttggaaatggctggaaatcagctgacgtgtcgccaaacaattttgttttatttg
atgttctgtctggctgtctcctcaagcgccaaagaggcagacgagaatgacgatacggat
gatgaaccagaatataaccaaccaactgttatgatagctattcttgttcgaaacaaagag
catgtgctgccctggtttttagagtatctggataaactgaaatatccaaaaaaacgaata
acattatggatcagaagtgatcacaataaagatgactctgtacgcatgctgaagcagtgg
ttagcagccgttaaagaccagtatcactctgttgatgtacaatatcaatatgatcaagag
tatgctgatgagcgaggaccatgcgactggagcaatgaacggttcactaacgtcatgaag
cttcgccaggcagcattggataacgcacggaaaatatgggcagactacctctttatgatc
gatgcagatgttgttttagaaaatccacaaacattgactcttctgatgaacgaggaaagg
gccatagtagcacccatgcttaatgccagtgtaggtgatacctactccaacttctggggc
ggcatgactgatggggggtactatagcaggtcagatgattactttgacatggtgggcaga
aaactgactgggtgtttcaaagtacctatggttcactcagctttcctcatcaatatgcat
catttgctgacagaaaagattgcctacaatcctgcgcctgagaattacaacggcccatat
gatgacatcattatttttgcctactctgtaaaagcagctggtctaagcatgtatgtgttg
aacactgaatactttgggaaggtgatgatacccctcgattactacaacaccctacgagat
gagtcggatcacttcacctttatcaaactagagactatggacgctgactttatatatgag
gagctaggagacagacaatatccagtaaagagacctccgctgcgcaggtcgccttacata
gacgtcgaggatccagtcgcagacaagatgatgtttgatgagatttacatgataaaccta
gtgcggagacctgaacgccgacagagaatgatggaagcactgaaagaattaggcatccag
gttaccatctttgatgctgtagatgggagacagctaaataacacctacttagacaagctg
ggagttgagatgatggatggatatgcagacccttatgctggcaggtcccttacaatggga
gaaataggatgctttctcagtcactttttcatttggaaggagatccttgacaagggttac
aagtctacactagtgttagaggatgacgtgagatttgagccgtacttcaggaccaagctg
atgcgtctacttcaggaggtggaggatcgaatacccgactgggatttgctatatcttggt
cgcaaacgtttgaagatctcagaggaaagttatgttgaagggtcagagactcttgtctgg
ccaagctactcttactggacactgagttatattctgtctaaccgcggggcaaaaaaactt
ctccagcaggaacccctcagcaagatgattcctgttgatgagtacctcccgattatgttt
gacaaacaccctgagggtaagtggaaagaacagttttcaccaagagacatagtaggtctg
tctgcctaccccttcttggtgtacccaacccactacaccggtgaacagagctacttctcc
gacaccgaggactcggtcaccatcttgggcgaggtcaatagcgaggcagtcaatctacac
aacaagaaggacgaattatga

DBGET integrated database retrieval system