KEGG   Mizuhopecten yessoensis (Yesso scallop): 110453690Help
Entry
110453690         CDS       T05079                                 

Definition
(RefSeq) double-strand break repair protein MRE11-like
  KO
K10865  double-strand break repair protein MRE11
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi03440  Homologous recombination
myi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    110453690
   03450 Non-homologous end-joining
    110453690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:myi03032]
    110453690
   03400 DNA repair and recombination proteins [BR:myi03400]
    110453690
DNA replication proteins [BR:myi03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     110453690
DNA repair and recombination proteins [BR:myi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     110453690
    BRCA1-C complex
     110453690
   NHEJ (non-homologous end-joining)
    MRX complex
     110453690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2 DUF4392
Motif
Other DBs
NCBI-GeneID: 110453690
NCBI-ProteinID: XP_021358430
LinkDB All DBs
Position
Unknown
AA seq 695 aa AA seqDB search
MPPTQDSEDDTLKILVATDIHLGYAEKDGIRGNDSLVSFEEILENAKKHDVDFILLGGDL
FHENKPPRRIMHGCISLFRKYCMGDKPVQFEYLSDQSKDFNHCQFPYLNYEDPNLNVSIP
VFSIHGNHDDPTGQGNLCTLDILHTSGFVNYFGKHTSLEKIEMSPLLLQKGSTKLAMYGL
GSIRDERLHRMFLKKTVSMLRPRENQEEWFNMFVIHQNRSKHTTTNYIPEQFLDDFLDLV
IWGHEHECRIEPEWNSVQNFYVSQPGSSVATSLSEGETVKKHIGLLQIKGKNFKMTKIPL
ETVRPFYMEDVVLSDTSLDPQDHNIAKKVEAFCAEKVEGLLEKAESEHSGNSKQPDKPLI
RLRIDYSGGFEPFSAHRFGQKFIDKVANPKDMVQFQRKKVLATKSDSKEDMGDLGAIKAD
ALDTSRVEDMVKDYFSSSDCKMQLKLLTEKGMGQAVQEFVDKEEREAISELVKYQLQKTQ
TYLKQRNANEEIIDAEVTRYKEERKKKKEDDEEVREAIKRARANRSQQEDDDEEGQVSPL
DSDDNEEPAVRGRGRGRGRGRGRGASEPKSRGRGSRGGRGEGTTTRGGRGRKKEAVVVES
QNRSIMDAFGATSQKSKKATSSRRHQMSESDDDILNISDEDDEFSNISSSSSRKKQPVAN
TSSNRKNTSSNKKRGVAFDDDDDDDDLFPTSKRRR
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaacacaggattcagaagatgacaccttaaagatactagttgccactgatatt
caccttggctatgcagaaaaagatggaattagaggaaatgattcattagtatcttttgaa
gaaattctagaaaatgccaaaaagcatgatgttgattttatccttcttggaggagatctg
tttcatgagaacaaaccaccccgcagaataatgcatggatgcatttctctgtttcgtaag
tactgtatgggtgataaacctgttcagtttgaataccttagtgatcaatcaaaagatttc
aaccattgtcagtttccatatttgaattatgaagacccaaatttaaacgtttctatccct
gtattttcaatacatggtaaccatgatgacccaacaggccaaggaaacctttgcacactg
gacattctgcatacctcagggtttgtcaattactttggaaaacacacatctctagagaag
atagaaatgagtcctttgctgttgcagaaaggttccaccaaactagccatgtatggacta
ggttctatcagagatgaaaggttgcacagaatgtttttaaaaaagacggtttcaatgttg
agacctagagaaaatcaagaagaatggttcaatatgtttgtgatacaccaaaatcgatcc
aaacataccacaacaaactacattcctgaacaatttcttgacgattttctagaccttgtg
atttggggtcatgaacatgaatgtagaattgaaccagaatggaacagtgttcagaacttt
tatgtcagtcagccaggtagcagtgttgctacatcactaagtgagggggagactgtcaag
aaacacattggattactgcagataaaaggtaaaaatttcaagatgacaaaaattccactg
gagacagttcgtccgttttacatggaggatgttgtgcttagtgatactagtctggatcct
caagaccacaacatagccaagaaggtggaagctttctgtgctgaaaaggtggaaggttta
ttggagaaagcagaatctgagcattctggaaacagcaagcagccagacaagccactgata
agactgcgtattgactacagcggggggttcgagcctttcagtgcccataggtttggacag
aaatttattgacaaagttgccaaccccaaggatatggtacagtttcaacgaaaaaaagtc
ctggctacgaaatctgattctaaagaagacatgggtgacctaggagccattaaagctgat
gctttggacacgtctagagtagaggacatggtcaaggactacttcagcagttctgattgt
aagatgcagctgaagttgctgactgagaagggcatgggtcaggctgtacaggaatttgtg
gacaaggaggagcgcgaggccatctcagaacttgtcaagtaccaactccagaaaacacag
acttacctgaaacagagaaatgcaaatgaagaaatcatagatgctgaggtgactcggtac
aaggaggagaggaagaagaagaaagaggatgatgaggaagtgagagaggccattaaaagg
gctcgggccaatcgctcccagcaggaagatgatgatgaagaagggcaggtcagtccacta
gactcggatgacaatgaggaaccagcagtccgtgggaggggccggggacgtggcaggggc
agaggcaggggggcatctgaaccaaagagccggggcaggggttctcgaggtggcagggga
gagggaacaaccaccagaggagggagagggagaaagaaggaagctgttgtagtagagagt
cagaacagaagcatcatggatgcctttggagctacatcgcagaagtctaagaaagcaaca
agttccaggagacaccagatgtctgaatctgatgatgatattctgaatatatctgatgag
gatgatgaattcagtaatatctcctcatcctcaagtaggaagaaacagcctgtagccaac
acttcctcaaatagaaaaaacacaagttcaaacaaaaaacgaggtgtggcattcgatgat
gatgatgacgatgacgatttatttccaaccagtaaacgtagaagatga

DBGET integrated database retrieval system