KEGG   Mizuhopecten yessoensis (Yesso scallop): 110454779Help
Entry
110454779         CDS       T05079                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1-like isoform X1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:myi04040]
    110454779
Ion channels [BR:myi04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   110454779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 DUF2798 GCR1_C Sensor IQ AgrB
Motif
Other DBs
NCBI-GeneID: 110454779
NCBI-ProteinID: XP_021360150
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MDQGEGDETRKCFIPKVEMRTGIFRSSKNKSGSNSYTVPTTYTDSHASTIPNYNATYLDP
KATYQTYEKGDIRTSMPLSRHARSTIQAQLYNFLERPTGWKCFIYHFTVFMMVLICLIFS
VLSTIDQYAGFAMETLYYMEIVLVCFFGVEYVVRLWSAGCRSKYMGMKGRIRFARKPISI
IDLIVVVASIGVFSVGSEGQVFATSAIRGVRFLQILRMLHVDRQGGTWRLLGSVIYLHRQ
ELITTLYIGFLGLIFSSYFVYLAERDEGRDDFSSYADALWWGVITVMTIGYGDKVPQTWM
GKIVASCFAVFAISFFALPAGILGSGFALKVQQKQRQKHFNRQIPAAATLIQCVWRCYAA
DPTSNSEATWKIHIHDSSNEETMLARMARRASLTLRKRRSSRMDSISIGNHVRRESLTSF
YQEDKIGTPRSNRRDSSRPNMMSNHPNVGGNDQYEDQMEYDLDDVEKVVQYVYRLTDAHK
TAIRVLRKIKYFVARRKFQQARKPYDVRDVIEQYSQGHLNMMVRIKELQRRLDQTLGKPG
TLYSNCYKDRERMTIGARIVRMETQMQKTDQKLDQVIFLLNSWLKSKPMNTDSLEDEV
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggatcagggtgaaggagatgagacgaggaagtgtttcattcccaaagtggaaatgcgc
acaggaatatttcgtagtagtaaaaacaagagtggtagtaactcctacactgttcctact
acctacacagattcacatgcatcaactataccaaattacaatgccacgtacttggaccca
aaggcaacatatcagacttatgagaaaggggacatcaggacgtccatgccactgtcccga
cacgcccggagtaccatacaggcacagctgtataacttcctggaacgacccactggctgg
aaatgcttcatttatcattttactgtgttcatgatggttcttatctgccttatcttcagt
gtcttatccactattgaccaatacgctggcttcgctatggaaactctttactatatggaa
attgttttggtttgtttctttggagtagaatacgttgtgcggctttggtcagcgggatgt
cgcagcaaatacatgggaatgaagggtagaattagattcgccaggaaacctatatcaata
atagatctcatagtggtagtagcttcaataggtgtgtttagtgtgggctccgagggacag
gtttttgctacctcggctataaggggggtgcggtttttacagattttaagaatgttacat
gtagataggcaaggtggcacctggagattgttggggtctgtcatatatttacacagacag
gagttaattaccaccttgtacattggatttctgggccttattttttcctcgtactttgtt
tacctcgctgaaagagatgaaggcagagatgatttttccagctatgcagatgctctttgg
tggggtgttataactgtgatgacgataggatatggcgacaaggtgccacagacttggatg
ggtaaaattgtggcttcctgtttcgcagtgtttgctatttccttcttcgctctcccggca
ggtattttgggatcagggtttgccttgaaggtacagcagaaacaacgacaaaaacatttc
aaccgacagattccagcagcagcaacacttatacagtgcgtttggagatgctatgctgca
gacccaacttcaaactccgaagctacatggaaaattcacatccatgactcgtccaatgag
gagactatgcttgcccgcatggccagacgtgccagtcttacactacgcaagcggcggtca
tcacgcatggactccatttccattggtaatcatgtccgcagggagagcctcaccagcttc
taccaggaagacaaaattggaactcctcgcagcaacagacgggacagctcacgtccaaac
atgatgtccaaccatcccaatgttggaggcaatgaccaatatgaggaccaaatggaatat
gacttagatgatgtagaaaaagtcgtgcagtatgtgtacagattaactgatgctcataaa
acagccatacgggtactgcgaaaaattaaatactttgtcgcgagacgaaagtttcagcaa
gccaggaaaccatatgatgtccgagacgttattgagcaatattctcaaggtcatcttaat
atgatggttagaatcaaagagttacaacgaagattagaccagacactgggcaaacctggg
acactatactccaactgctacaaagatagggagaggatgacaataggtgctaggattgtc
cgcatggagacacaaatgcagaagacggatcagaagcttgatcaggtgatattcctctta
aacagctggctcaagtctaaaccaatgaacacagactcgttagaggatgaagtatga

DBGET integrated database retrieval system