KEGG   Mizuhopecten yessoensis (Yesso scallop): 110457434Help
Entry
110457434         CDS       T05079                                 

Definition
(RefSeq) microsomal glutathione S-transferase 2-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00480  Glutathione metabolism
myi00980  Metabolism of xenobiotics by cytochrome P450
myi00982  Drug metabolism - cytochrome P450
myi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:myi00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    110457434
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110457434
   00982 Drug metabolism - cytochrome P450
    110457434
   00983 Drug metabolism - other enzymes
    110457434
Enzymes [BR:myi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110457434
Transporters [BR:myi02000]
 Other Transporters
  Pores ion channels [TC:1]
   110457434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 110457434
NCBI-ProteinID: XP_021364396
LinkDB All DBs
Position
Unknown
AA seq 155 aa AA seqDB search
MSTPIYVENVALLGIVTLAGGYQLASFAKRVGKKRYQVKLAYPAITGNPEFELIYRAQQN
CLEFYPIFMSAFWTSGIFFHPAPTFLAGVVYLYAREKYFTGYSKSVEGRMSGFRWSVRGL
MSLLAMGGVGLCHAVLKQYAGINVYEQYLQQYLKF
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaccaatttatgtggagaatgttgctttgctaggaatagtaactttggccgga
ggttatcaactcgcaagttttgcaaagcgagttggaaagaagaggtaccaagtgaagcta
gcttacccagctataactggtaaccccgagtttgagctgatttacagggctcaacagaac
tgtttagaattctacccaatatttatgtcagcattctggacatctggcattttcttccat
ccagcgcctacctttcttgctggagtggtttacctgtacgcacgtgagaaatacttcaca
ggttactctaagagtgtggaaggaaggatgtctggcttccgctggagtgtgcgaggcctg
atgtcgttgctggctatgggaggagtgggactttgtcacgccgtactgaaacagtatgct
gggatcaacgtgtacgagcagtacctacagcagtatctcaagttttaa

DBGET integrated database retrieval system