KEGG   Mizuhopecten yessoensis (Yesso scallop): 110457536Help
Entry
110457536         CDS       T05079                                 

Definition
(RefSeq) probable histone deacetylase 1-B
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:myi00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    110457536
Enzymes [BR:myi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110457536
Chromosome and associated proteins [BR:myi03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     110457536
   HDAC complexes
    Sin3A-HDAC complex
     110457536
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    110457536
  Chromatin remodeling factors
   NuRD complex
    110457536
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110457536
NCBI-ProteinID: XP_021364536
LinkDB All DBs
Position
Unknown
AA seq 517 aa AA seqDB search
MATQPHSKKRVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLILNYGLYRKMEIYRPHKAT
QEEMTKFHSDDYIKFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGMYEFCQLSTGGSVAG
AVKLNKQASDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYVDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDESYESI
FKPVMTKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTLKGHGKCAEFMKKWNLPLLLLGG
GGYTIRNVARCWTYETSIALGVEIANELPYNDYFEYYGPDFKLHISPSNMANQNTGEYMD
KIKTRLFENLRMLPHAPGVQMSAIPEDALNDESDDEDKENPDTRVSIRANDKRIACDEEF
SDSEDEGEGGKRDRQNYKPKMKRPRTDDEKKEGEKDAKEPKKDSPAENKEEPAKAVAEKT
EEKTETAEKKESVTPPSKPEQPAETKEDTISATKMEH
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctacacaaccccacagtaagaaaagagtgtgttattactatgatggtgacattggg
aattactactatggccagggacatcccatgaagcctcacaggatacgcatgacccacaat
ctcatcctcaattatggactctacaggaagatggaaatctatagaccccacaaagccaca
caggaagagatgactaagttccatagtgacgattacatcaagttcctgaggagcatccga
ccagataatatgtctgaatacaacaaacagatgcagcgcttcaatgttggagaggattgt
ccggtgtttgacggcatgtatgaattctgtcagctgtctacagggggatctgttgctggg
gcagttaagctgaacaaacaggcatcagacattgccattaactgggccggaggtcttcat
cacgctaagaagtcggaagcttcaggattctgttatgtcaatgacattgtccttgccatt
ctagaacttctcaaatatcatcagagagtgttatatgtggacattgacatccatcatgga
gacggagttgaggaagctttctacaccaccgaccgtgtcatgactgtctcatttcataag
tacggggagtacttcccgggcacaggtgatctcagggatattggtgcaggcaagggaaag
tactatgcagtgaactttcctcttcgggatggcattgatgatgaatcatatgaatctata
ttcaaaccggtgatgaccaaagtcatggagatgtatcagccgagtgctgtggtgttacaa
tgtggagcagactccctgtctggtgacagactcggctgcttcaacctcacactaaaaggt
catggaaagtgtgccgagtttatgaagaagtggaacctgcctctgttattgttgggagga
ggtggttacaccataaggaatgtggcccggtgttggacttacgaaacgtctatagctctc
ggagtagaaatagccaatgaattaccgtacaatgactactttgagtactacggacctgac
ttcaaactacacatcagtccatcaaatatggccaatcaaaataccggggaatacatggac
aaaatcaaaacaagattatttgaaaacttgaggatgttgcctcacgctccaggtgttcaa
atgtcagccattcctgaagatgctctaaacgacgaaagtgacgatgaagacaaagaaaat
ccagacactcgagtctccattagagcaaacgataagagaatcgcttgtgatgaggagttt
tctgatagtgaagatgagggagagggagggaaacgtgaccgacagaactataaacccaag
atgaagcgacctcgcaccgacgacgaaaagaaggaaggagagaaagatgctaaagagcct
aaaaaggattcacctgccgagaacaaagaggaaccagcaaaggcagtggccgaaaagacc
gaagagaagaccgaaacagctgagaagaaagaatctgtgacacccccaagtaaaccggaa
cagccagcggagacaaaggaggatacaataagcgcgactaagatggaacattga

DBGET integrated database retrieval system