KEGG   Mizuhopecten yessoensis (Yesso scallop): 110458440Help
Entry
110458440         CDS       T05079                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi04140  Autophagy - animal
myi04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:myi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110458440
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110458440
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myi01001]
    110458440
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:myi03019]
    110458440
   03036 Chromosome and associated proteins [BR:myi03036]
    110458440
Enzymes [BR:myi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     110458440
Protein kinases [BR:myi01001]
 Serine/threonine kinases: AGC group
  PKA family
   110458440
Messenger RNA biogenesis [BR:myi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     110458440
Chromosome and associated proteins [BR:myi03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110458440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 110458440
NCBI-ProteinID: XP_021365804
LinkDB All DBs
Position
Unknown
AA seq 411 aa AA seqDB search
MDFFFDLFDSEKKRRAAQQQADNRNRTGSGGELPPLRIDGRGHHAFSFRKYDTRDTNRVR
DERTKRELHRLYLWDIKEFLTKAKEDFTHKWDHPQQNTACLDDFDRIKTLGTGSFGRVML
VQHKQNREFYAMKILDKQKVVKLKQVEHTLNEKRILQAINFPFLVSLEYHFKDNSNLYMV
LEFVTGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDTHGY
LKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNAVNDIKNHRWFQS
TDWIAIYQRKVDAPFVPKCKGPGDASNFDDYEEEPLRISSTEKCAKEFADF
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttcttcgacttgtttgattctgaaaagaaaagaagagcagctcagcagcag
gcagacaaccgaaacaggaccggaagtgggggcgaactgccccctctccgaatcgatgga
cggggacatcatgcttttagtttcagaaaatatgacacaagggacacgaatcgtgttaga
gatgaacgaacgaagcgggaactccatcgcttgtatttgtgggatatcaaggaattccta
accaaagccaaagaagattttacgcacaaatgggatcaccctcaacagaacacagcctgc
cttgatgactttgaccgaataaagaccctagggacagggtcatttggtcgggtcatgttg
gtgcaacataagcaaaacagggaattctatgccatgaaaatcttagacaaacaaaaggtt
gtgaaattaaaacaagtagagcataccttgaatgaaaagaggattttgcaagccatcaat
tttccattccttgttagtttagaatatcatttcaaggacaactcaaatttgtatatggtg
ttggagtttgtaacaggtggagaaatgttttcacatctcaggaggataggaagattcagt
gagccacattcccggttttatgcagctcaaatagtattggcatttgaatatcttcattat
ttggatctcatttaccgagatctcaagccagagaatttacttattgacactcatggctat
cttaaagtgacagactttggctttgccaagagagtaaaaggccgcacctggacactgtgt
ggtactcctgagtacctggcaccagaaatcatcctcagcaagggctacaacaaagctgtg
gactggtgggctttaggagttctggtgtatgaaatggcagcaggctatccaccctttttt
gctgaccaacccatacagatctacgaaaagattgtctcgggcaaggtacggttcccctca
cacttcagctctgacctgaaggatctattgcgtaacctgctacaagtggacctcacaaaa
agatacggcaacctgaagaatgccgtcaatgatataaaaaatcacaggtggttccaatcc
acagactggattgccatctaccagaggaaggtggatgctccttttgtacctaaatgcaaa
ggccctggggacgcaagtaacttcgacgattacgaggaggaaccactgagaatatcatcg
acagaaaagtgtgcaaaggagtttgcggacttttga

DBGET integrated database retrieval system