KEGG   Mizuhopecten yessoensis (Yesso scallop): 110458931Help
Entry
110458931         CDS       T05079                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00590  Arachidonic acid metabolism
myi00790  Folate biosynthesis
myi00980  Metabolism of xenobiotics by cytochrome P450
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    110458931
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110458931
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110458931
Enzymes [BR:myi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     110458931
    1.1.1.189  prostaglandin-E2 9-reductase
     110458931
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     110458931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-GeneID: 110458931
NCBI-ProteinID: XP_021366588
LinkDB All DBs
Position
Unknown
AA seq 284 aa AA seqDB search
MRTPISDKKVAIVTGASRGLGLAIVRGLCRTFRGHVYLTALNSEEAEDAISQLRWEGLDP
KFYQLDITDKCQVEKLGEFLKNYYGNIDILVNNAGIAYTSKDVESFSTQAAMTCRTNFYG
TLHVCKILFPLLRSHSRVVNISSNVAKIAMAMCSDQVRDRLTDSNLTMTELQQLIHSYVK
ATESGTQVEEGWPITPYAVSKIGITVMTFIQQREFHQNIRSDIRSDIVVNACCPGFISTA
MTRHRGTASPDQGADTPLFLANLPMETTSPCGDYVMNREVQSWG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccccgatatccgataagaaagtcgcaatcgtaactggtgctagtcgaggactg
ggattggccattgtccgcggtttgtgccggacattccgtgggcacgtgtatttgacagct
ctcaatagtgaagaagccgaagatgcgattagccagcttcgatgggaaggactagatccg
aaattttaccagctggatataaccgacaaatgccaagtggaaaaattgggggaatttcta
aagaattactacggaaatattgacatactggtgaataacgcagggatagcatatacgtcg
aaggatgtggaatcgttcagcacgcaggcagcaatgacgtgcaggacaaacttctacggc
acgcttcacgtgtgcaaaatacttttcccgttactcagatcacattcgagggttgttaac
atctcaagcaatgtcgccaaaatagcaatggcgatgtgcagtgaccaagtgagagatcgg
ttgacagactccaatcttacgatgacagagcttcaacagctgatccacagttacgtcaaa
gccacagagtctggtacacaggtagaggagggatggcctatcactccgtatgctgtgtct
aaaatagggatcacagtaatgaccttcattcaacaacgagagttccaccagaacatccgg
tcggacatccggtcggacatagtagttaatgcctgttgtcctggatttataagcacagcc
atgacgcgccaccgagggacagcatcacctgatcagggtgctgacacgcccctgttcctc
gcgaaccttccaatggaaacaacgagcccctgtggcgattacgtcatgaacagggaggtc
cagtcctggggctag

DBGET integrated database retrieval system