KEGG   Mizuhopecten yessoensis (Yesso scallop): 110460322Help
Entry
110460322         CDS       T05079                                 

Definition
(RefSeq) histone-lysine N-methyltransferase 2C-like
  KO
K09188  histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110460322
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myi03000]
    110460322
   03036 Chromosome and associated proteins [BR:myi03036]
    110460322
Enzymes [BR:myi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110460322
Transcription factors [BR:myi03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    110460322
Chromosome and associated proteins [BR:myi03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110460322
   HMT complexes
    MLL3/MLL4 complex
     110460322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN zf-HC5HC2H SET zf-HC5HC2H_2 HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 110460322
NCBI-ProteinID: XP_021368837
LinkDB All DBs
Position
Unknown
AA seq 7397 aa AA seqDB search
MPGTEEKKVEESSVSTSKSKAAILDLNSDNSQSPSCAPPDITNTDQRFHVYGNQTELSEP
PDLNPEEHTGLLQSSSPDALLTAHAEEQIDLGNSSEPPDITGTDAFPYTGETSDPEDGIP
IDCPDFQHSLGHTSTHQSDQSLGILLSDDFDPGESEAPDPYFGESQAPTELLDSDDCSTE
GFLASSFPESSLVESLQAVAPGDILAVSLPQPPPITLKLSAPPIKRGPGRPRKDGVGPIQ
RKRVSLGKTSTKSSIKKGVHIHPSFAGLVRSFQGSAMDTGPMDTANPEAAQVVAPDIAGP
SSSSMMLDYDQDMPIPGMAMEDDQASSSYSVMSGEGSDPLEPLIPTKLCSLCNCGERSLL
GQGELGKYDPTQGFNPLKKTLGKSRNKTPEFDERTTSEKGPKPLTWRRHRGPLKGNNDIL
QLNRERSKSPRRYPHNSDEDPTCILGDELSMVGYPEDIDLTQVFEPSGHTLAHHCCAAWS
EGVVQTHDLLLKYVDRAVYTGLSQKCSYCRNYGATINCRVTKCNKKYHYPCASARGCFQD
IKTLSLLCPDHTDQAETIAGEEALCVICDLVGNISEQLFCTSCGHHYHGSCLHPSVAMTP
EVRAGWQCPDCKICQMCRHPGEDSKMLVCDTCDKGYHTFCLKPVMTTIPKNGWKCKNCRV
CGDCGSRTPGSGPSSRWHLNYSVCDSCYQQRNKGLSCPLCGKAYRQFTQKEMILCNTCKK
HVHAECDETIDSGLLQKVKEGLDTDYTCAFCRNRDPDMDLPFPYALPGPPDDSSEDYLLN
DDLETMSFMDDGSNSFLMNEDSVSSIDIDISVIEKGAAQLSQLTSPSHPHPHGEGHGIGS
KGGKLSAMSRKKMGAGRPRGRPIAPEKKKRPPTFGERKRGPKPKLKTGQLGISGQVTTLP
VGESKTKSQDDDDDGDDHPTTLILANSKDEFVLEQDVCKSCGSFGKGKEGKLIVCTQCGQ
CYHPYCVSVKVTKVVLQKGWRCLDCTVCEGCGKPHDEGRLILCDECDISYHIYCLDPPLD
HVPKGTWKCKWCVMCVNCGSTTPGFGCQWQNNYTQCGPCNSKQECPACQRNYHEDELVIQ
CVQCDRWIHGHCDQLKNEDDAERAADFGYHCLFCRPKTGQPGPLPPPPPPSPPEEVEMKP
LSPPPLPPPPPPPPPLPPREPEPPKKFFLDGVCLSESGHQQIQSITVQVPKPKRVRKKTE
VKPAVSEVAGMLSQAPSAARLVSMQSQSSIDGDESMDILKDDDGKLVDLGEGLSIPPSAL
MEGDLGPDGLALLSPTLTPGLPVTSDGAPVPEKKKRCRRNTVNIGIGGFMVRSRVRPQAK
QQAASTDTAGTLEEGQSKPEGATEVTDKPLAEGETPAEEPKKKRIRRTKKKSALEENFPT
YMQEAFFGKDMLDKTKTTSKESVKIDSGSDLDEARTSPVTLDFRGDNQPLINQGLLSTSP
VKVPSSSHLLPSVGQPLLNPLGVHDELQDSDLDLLPDALPQDDELLSIINKELAKDQDDL
PMLPGGTMEVDPRSEESSHKPELQANLDGILSPNLDDEKNLDVDKILSEGLVHMDSKTVE
DIFKGVLENDPRPSVPTAPQGFNMPGPNPHIPGKEQPQPPGMDPTQVPMNPGMGQGGLAP
LVMPPPPGFPSSFSSPSSMSPGGFPNNQPPWQQVMAQEEEQQEQVTSRRNMQKWESDEEL
GEHATISAVLYCNLKHPELRHEHPDWQERVKKIGKIWRQLPSDDKQPYLLQARKNRSSSK
GQKARKAKREQAAAAAAAMGPPPIPSYSQPTTPDGLGSPMSGMAPGQEICSPLSRSSSNS
QIIAPKTPDGQSPSHMMGGVPLSPNHQGVQSMMHLQDPYAQPLGTPMSMDMAGMGPRPMR
PQIRPQDPYAQAPSTPRPHVPFSQPRPQGPFQPGMNMQQRPQDLYVQHPGVPRPPNMYSQ
HEASSRPPGPYNHPSSLPPDQIGGPFRGPPGRVPDLFNQDNDAYTQQMSTARGSVPTTPQ
QSPSKSQWPGMAQESDPYEHQVPTPRPMMPITVEGMSSPSTPQTPTSQPFDPFSQHPSGP
PRSGQHPGMAKPMMSRQTSVPSDPYAHPPSTPGGPMNRPDDPYAFSPPTPRPVSESYSPR
STGKAELSPQQVGHRPIGGDPYTQMIPGKGPMPGQPGPEGYLQHPNMPGGPQRSMSGPQA
QQIPPADSFGMPLRHPFRAPVPPTSQVRPHGYQESHMPQGPHHHGSMEPPKEPSVLQQMF
AAASRRHAQFPFSGMFSTLKHNYLGGGGGMDKHIHPQQVRDILAEQTKKRQQKKMEMINK
QMSEEGVPPTGLPSPHPGGPGGFSPEEGPRFPSPGGQNPGMDRWAHNQQQMVRPPQARQF
RPPDMEMFLRGQFEGARPGVPGVMRQPRPPGPLSPHNQFSPRGSSPQMSPVPGQHAVYKP
QLLQLVQERIRPGQQPNSGKPQPPTPGPATPGVQPPPGFEQFSPAGDLPKMPFDPNRPPS
QGQPIPAGIPPVQQPQVKTEQKEALPGKTEEVSGRVMKTQKQVMSSEDEKQDTEDENISD
LLDNDGSFDILKYADPELDFDLDDQGKSILDDLVEESKADDSESEVKSEMDAPRSIKPEE
KEVTETPESIKMEDDKTETGPKSVTAMGAVDFQAKFLEFSQRKQEERHADGTPGPSDQKP
PITEADKNKNKSQIAAILQNTDHMRPQLERRDSQKSDSGSLGKDLLPRTPSGTPLGLGMD
LSPMGQAGMQLPSRPLYSSGMPSPLHQMAQVYPGSHTQPSPSSTAGKYPQQSPGTPSLPS
PKVLPSPKSNIPSPRTPNVPSPFSQQSGLGGQLSPFSQAVQSPFSPPVTTAAHSPFSAPP
ATSSAPQSPYGPPGRTQSPFTIPVTGSPGNSQSPFGAMSQPSPMSASQAPGQRSPRGTIT
PTNQYMQGTYGQPMMPVPPRGATTLQPTPNSILYGQSSAAQQISKGPTGMPGPRMPFTSQ
GMPQQGPPQPMDHQHQQQHMEMTSPGGTPLMRMPRVSLPEGVTPEQAMQFQNQQQVPVSM
YQGNMQGPRPQGVMMGVPGPNQPPGPPGHPGMRMQGMRPPTPTATSTSQSKVRLLQDQPL
LIQDLLDQVLEKKSLVNTQKNVFGSGTRSWNPEQEKQEQQRQAQQQAILHRRDNPGGMEG
MPPGSMPQGVMTPGNMPPGSMVPGSMPPGGMPPGSMPPGSMPQGGMPPGSMPPGSMTQGG
MPPGSMPPGAMPPGGIPRMEGMQRPPGFPMQGYRPRMEHPGDPNQWPRMFGPSEGGPPQQ
GKPGFPPGVNQGVRMPVQQMRQFAPGVPPQQGPGQGPGPNTGGPGGPGGPGIAPPPIPPP
VPPMQGELNPELERQHLQYEEWLVKQSQYLEMQVKALEQQINKCKRTKKAINARGRSAKK
ANKEVPIQDTQELERVTQEQSMLQKQLEGLRKQFRTHQMQAQEYRTKKRERFGLPVQPPV
PSQPSPTTGVPDTVMVGALQPRIPGGPGTIRLTASARQEYDNYMQQRLRQQQQQQQQQQI
GARPPLHTVVEYTQGKTTSKKKKATKVCKATTIQKKAKVPVTKSPVSMFKFKCKCCLICC
MHLCLTGIKFRKTRNIEKHFCRLEITLWTNGLKLQKKAKVPVAKSPSADNNPFSEEYYER
EQIQKQHERLHIAPGQQATMGQPPSSGPGDTPDANRQMHQFFGGERPPFEGSGPYGGPRM
PAPGEPRPRFPGEHGPRFLGDQGSRFPGDPNQGPRFPGDQGQRFPGDPNQGPRFPGEQGH
RFPGDQSARFPGEQGQRFAGPRFMFDPRMGSPGERPPYPGPNPAAMRMPGMPGMPGMPGG
PGGPGGPVGPGGPGGPGGPGGQGGIPTFQSSFGLPPSANMQQQPSEVGSAGQEQPMEKPK
PKKRKKKKKQPAENAGSTASTTPANPGPPTAEARPPIQFTPQSETEKRIMEILNNTAKGL
VKAQPSDKPDTFKSQDSSKSPASVASSDKKPETSQPKDVTATSPAGSVAPSPAGLGQVSG
QTVPHPGLSVRPPGPGDMALGKPEMYTNQRPPGLPGQQQLPPPPPSQPQMSAAHQETRVE
AEDSHTESEPIMPMNVMIQQSVPQRVQGPTESPVTLTHHEGGPPGKEPEPHSGIAGLQSV
VPNGTPTGPYPYSSQQAILGLPPHMAQIGPMTQGPHGHNLQRQGVPPRSPHMASMQERQS
PHPGQDRKSPHAASHSPHPGGMQERKSPHAAGKPAHMGIPGSHPDQHTTHMQESVRVSER
KSPHSAGQYLGIVHDHHSPRQSPVGQHSDRQSPRQALQGGPYMGMTYDHISPRQSPHPIG
QHLDRQSPRQMGQAGPYSDRQGPYGAMMERQSPHAHETQSPNAAGSPRGPGAEPRQIQQD
KSASRQSQQASAERMSPRAPGPGFPYGPFPQMGPGPMRYQGPGGKPHSSAPTTQPGTQGP
PGYMGPRGPPGHHRQISPGPAGSPGHVGHQGLLNYPSPRGPRPQNFPLLSESQLRMMNPQ
QHGSQPSGGMHGQLQHQQVPSSSGSPISSQPATLSTEDDKKPGQDFSDSVQCGPQPPSEK
CSDGIHCGTPPPENPQVVCSDGIHCGTPPPENPQGVCSDGIHCGTPPPENPQGVCSDGTH
CGTPPPENQQGVCSDGIHCGTPPPEKPQGVCSDGIHCGTPPPENQQGVCSDGIHCGTPPP
ENPQGVCSDGIHCGTPPPENSQGVCSDGIHCRTPPPENPQGVCSDGIHCGTPPPVNQQGV
CSDGIHCRTPPPENPQGVCSDGIHCGTPPPENPQGVCSDGIHCGTPPPENSQGVCSDGIH
CRTPPPENPQGVCSDGIHCGTPPPEKPQGVCSDGIHCGTPPPENPQGVCSDGIHCGTPPP
KNPQGVCSDGIHCGTPPPEKPQGFCSDGVCSDGIHCGTPPPENPQGVCSDGIQCGTPPPV
NQQGVCSDGIHCGTPPPENPQGFCSDGIHCGTPPPVNQQGVCSDGIHCGTPPPENQQGVC
SDGIHCGTPPPENQQGVCSDGIHCGTPPPENQQGVCSDGIHCGTPPPENQQGVCSDGIHC
GTPPPENQQGVCSDGIHCGTPPPENQQGVCSDGIHCGTPPPENQQGVCSDGIHCGTPPPV
NPQGVCSDGIQCGTPPPVNQQGVCSDGIHCGTPPPVNQQGVCSDGIHCGTPPPENPQGVC
SDGIHCGTPPPENPQGVCNDGIHCGTPPPENPQGVCSDGIHCGTPPPENPQGVCTDGIHC
GTPPPENPQGVCSDGIHCGTPPPENQQGVCSDGIHCGTPPPENQNGVCADGRNCNTPPPP
SQPDTSIVTSNPQSDSTEQVENNSEPMDTGPPVIPNDQHPVPFPNQVNQSEVQSQCRSSP
ISKNVPVNIFKPIAPPNVATTNLSTVPEPIVVTTVVHPVCPTPPSSTGPVCKDEAVPSPQ
PPVPVLPRTAPLSFMGHASSDVPSHHQPLVPSSGSAFTGEVVPVSRPTHITPNTAPENCP
TTDTVTTMTTQPPVSSPVTFGGSAESLCANTRIATPSSSSIAPAPVLPVSSIAPPSTHIP
TLVSTSYPEVGDKTIPPISSQSEVVIPSTDAYPHVALNSGSEPKLVPTPSTSPRGSKPAQ
LPQTAEGPTAPLMQHSDKSPIAIDIPLSTPNSVPSKMPASTEGFLEAKLPTSTHGSLASH
APPCTQHSITTIPQSAPGSVSIHLPPDATPGASVKHAMPHQQHAERHPGLMPSMPQAAGI
PAHTPGMALSSASSALQQMASVVPTGFAAPPGIPQTSASDTVEQTSVSHPTVMELQQQTM
LSQAMAHSSIAASIPSSTALSTGLSSSVAGPGPHQPPFQHMYQGGQKGPIPRQMMPSASM
PGPNTSIAVSRQGGHPSMVPTYPMAQGMPRMPPHTRMGMMGPEQRPPQMSMMGPRPYPPQ
GARPPPGLQHMPSHQRMKMPPGYPQYHMPPHMQRMPPPMLRPEQMSTDGAPMSSHMGPQG
MMESMGEQFPPGTMPMSTMASHQHLSHPPYSNTSPGAPQLVASNHQMENMMRMRHPQYPM
GPGFPQRMPPHMVGMPPGSGGNPPGGQRFQDHMVAMANKMSSPQGSEAGPHPPYMGVHSQ
MQDHAGLPGVLMTALSTVPITTLTPSLPVSLSSISGPNCTPPMPHPSPSPSCTPSRTPSR
ASSNPSPQSGIHIHTPTSPMIKNELMMSGPEGLARQLSGEIRIKEEPMDISQKLPGMLTE
EDDLKIRQNAILKQLLGTAGMNAFKKQMLPGSADGGTMESEDGSPVQLTPEQQRQLEMIE
QMPLLKEAEISAEEWDIKTPEEKEKILEGLVLAEMRKQEYEAKRKEFEETRKAKRKTGET
RKRKKKKQQEQQAQETPAGEEEQAMMPAPVPPIVEGQGPPPVTTPPVLPVPTQPQPKKRQ
RKSKAKNADPSKDKDKDGKLESFYSSLNSLPVVPLQEPRVGSFFSISPVHGSAALLTGEN
QLKGTFGASYLEGVADYYGSTLLVGLPPLESFVGLSRPRDIETRRKYITDGHDRPVVGSQ
SDSQRYQLSQNQEIQNRFMMQGHPTQQSPQYQNHAMFGAQMIGPRDKPVPPTLPPPPRIE
PRLDLVSRGSDSPETVISSSSPEHGFGEVEEEYPMLRPIDPAPIDDRASPSMPLVQPVVV
KASPIRPKSTDSHFEIPEKTYGHPRPLIDSDVLDRKWGYDPMSISGKENDLTQSLTSSLT
KPFRDADLKQDISVTVTLSAKSADDIGGVLSTIAELLKIAVPPTYEMSRSPSPDTYKSVT
KHKEQAVNIHSLIKAKPKFCRHCQTVVMEGGVRKRRSEIPCLKKEDQFTFKDIEDEEVTF
CTSDCCSQYIAICQMIQPPPKLVEPKEEILEPPPQPTTLVSPVKTFDLSSPLTDTSTLSG
NEALPVPSTPSTPTSSGVSTPTVTPTTPVRQKSEEKLQKKLKRSNSYYDKPLEKKWKGKR
YKYVLNEVVESLGVAPGMPEIEVDVLWKALGTIIIPDPLPKDNRVCAFCQFGGDEVSDGP
GRMLNMDVDKYIHLNCALWSSEVYETLNGALMNVDMAYTRGLRTECVVCKNVGATLECFK
SRCGNYYHVGCANKQGCMFFQDKTLLCPGHAPKLAPDNVLESLVVHRRVYINRDEDKQVA
SMVHRQQEGNFTLRVGSLILHSIGHLMPYQIVSAKYHTRDYIYPVGYKSSRFYWSMRRLY
KRCRYVCSVYENEGQAGFKIQVVERGFEDLVMEDNTPRGVWSKVLEPLDKMRKNADLVKI
FPNFITGEELFGLTEPTIIRVLESLPGTDQLTNYHFKFGRSSLIDMPLLINPTGCARTEP
KMRTHFRRPHTLQSSNTSRSLPTTVTGVTGDLNSPYMKQFVHSKSQQYRRLKTEWKNNVY
LGRSRIQGLGLFAAKDTEKHTMVIEYIGDLIRNEVANRREVIYEEQNRGVYMFRIDNEVV
VDATMAGGPARYINHSCNPNCVAEVVAFDKESKIIIITNRKLAKGEELTYDYKFDFEDEQ
HKIPCCCGAPNCRKWMN
NT seq 22194 nt NT seq  +upstreamnt  +downstreamnt
atgccaggaaccgaagaaaagaaggtagaggaaagctctgtctccacctcaaaatcaaaa
gccgccattttggatttgaactctgacaacagccagtccccctcgtgtgcaccaccagac
attacaaacaccgatcagagattccatgtctacggcaatcagacagaattgagtgagcca
cctgacttaaacccggaggagcacacaggcttgttacaatcctctagtcctgatgcattg
ttaactgcgcatgctgaagaacagatagatctgggcaattccagcgagccgccagatata
accgggacagatgcattcccatatacaggggagaccagtgacccagaagacgggatacct
atagactgtccagacttccaacatagtcttggtcacacctccacccatcagtcagatcag
tcgttgggcatactgctatcggacgattttgatccaggagaatctgaagctccagaccca
tactttggagagagtcaagctcccacagagcttttggattctgacgactgctctactgaa
ggctttctggcatcctctttcccagaatctagtttagtggaatctttacaagctgttgct
cctggtgacattcttgctgtttctctgccccagcctccacctattacacttaaactctcc
gctccacctattaaacgtggcccagggaggcccagaaaagatggtgttggtccaattcag
agaaagagagtgtctcttggtaaaaccagcacgaagagctccataaaaaaaggtgtgcat
atccacccaagcttcgcaggtcttgtacgctcatttcaaggcagtgctatggatacagga
ccaatggacacggcaaacccggaggctgcacaggttgtggcgccggacatcgctggacca
tcctcctcctcaatgatgctggactacgaccaggacatgcccatacccggcatggctatg
gaagatgaccaagcttcatcaagttactcagtgatgtctggagagggctcagatcccctg
gaacctttgatacccacaaagctatgcagcttgtgtaactgtggggagcgtagtctgctg
ggacagggggagttgggcaagtatgatcccactcagggctttaacccactcaagaagaca
ttaggcaagtcccgtaacaaaacccctgagtttgatgagcgtaccacaagtgagaaaggt
ccgaagcccctaacctggagacgtcatagaggaccacttaagggcaacaatgatattcta
caacttaacagggagaggagcaaatccccccgtaggtatccccacaactctgatgaagac
cctacctgtatacttggggatgagctgagcatggtcggatatccagaagacattgacctg
acacaggtgttcgaaccatcgggacacacactggcccaccactgctgtgcagcctggtcc
gagggggtggtccaaacacacgatctgctgctaaaatatgttgatagggccgtctatact
ggtctatctcaaaagtgcagctattgccgtaactatggtgctactatcaactgtcgtgtg
acaaagtgcaataaaaagtatcattatccgtgtgcatcagcaagaggctgtttccaggac
attaagaccctgtcgttgctgtgtcccgaccacacagatcaggcggaaacaatagctgga
gaggaagccctgtgtgttatatgtgatctggtgggcaacatttctgagcagcttttctgt
accagctgtggccaccactaccatggcagttgtttacatccgtctgtagccatgacacca
gaggtacgggctggatggcagtgtccagactgtaagatctgtcagatgtgtcgacaccca
ggagaagatagtaagatgctggtatgcgacacctgtgataaagggtaccacactttctgt
ctcaaacctgtcatgactaccatacctaagaatggctggaagtgcaagaactgtcgtgtg
tgtggtgactgtggttccaggaccccaggaagcggccctagctcacggtggcacctcaac
tactcagtctgtgatagttgttaccaacagaggaacaaaggcttgtcatgtccactgtgt
gggaaggcataccgacagttcactcagaaggagatgatactgtgcaatacttgtaaaaaa
catgttcacgccgagtgtgacgagacaatagactctggccttctacagaaagtcaaagag
gggctggatactgattatacctgtgctttttgtcgcaacagagatcctgatatggacctg
ccattcccatatgcactaccagggccgccggacgactcttctgaagattacttattgaat
gatgaccttgaaacgatgtcgttcatggatgatgggtctaactcattcttaatgaatgaa
gattccgtgtcgagtatagatattgacatcagtgtgattgagaagggtgcggcccagctc
tcccagcttactagtccctctcatccccacccccatggggagggccatggcattggcagc
aagggaggaaagcttagtgctatgagtcgtaagaagatgggcgctggtaggccaaggggg
agaccaattgcaccagagaagaagaaacgccctccaacttttggggaaagaaaacgagga
ccaaagccaaagttaaaaactggccagctgggcatttctggccaggtaacaactttacca
gttggagaatctaaaactaaatcccaggatgacgacgatgatggggatgatcatcccacc
acacttatcctcgccaactctaaagacgaatttgtcttggaacaagatgtttgtaagagc
tgtggtagttttggtaaaggaaaggagggcaagctgatagtgtgtactcagtgtggacag
tgttaccatccttactgtgtcagcgtcaaggtgaccaaggttgtgctacaaaaaggctgg
cgatgtttagactgtactgtgtgtgagggatgcggaaagccgcatgacgagggtcgcctg
attctgtgtgacgagtgtgacatcagctaccacatctactgtctcgacccgccactcgac
catgttccaaagggcacctggaaatgtaaatggtgtgtgatgtgtgtgaactgcgggtca
accacgcctgggtttggttgtcagtggcagaacaactacacccagtgtggaccatgtaac
agtaaacaggagtgtccagcctgtcagagaaactaccatgaggacgaactggtcatccag
tgtgtacagtgtgaccgctggattcatggccactgtgaccagctcaagaatgaggatgac
gccgagcgtgctgcggactttggctaccactgtctattctgtagacccaagactggacag
cctgggccattgccgccacccccaccaccatcacccccagaagaggtagaaatgaagccc
ctgtcccctccgccacttccacctccaccacctccacctcccccactgcctcccagagag
ccagaaccgccaaagaaattcttcctggatggagtgtgcctctctgagtctggtcaccaa
cagatacagagtatcacggtccaagttccaaagccaaagcgagtgagaaagaagaccgag
gtgaagccagctgtctccgaggtagcgggcatgctttcccaagctccctctgctgctcgg
ctagtgtcaatgcaaagtcaatcatctattgacggtgacgagtccatggatattctcaaa
gatgatgatggaaaattggtggaccttggtgaggggctgagtattcctccatcggccttg
atggagggggacttaggtcctgatgggctggcacttctcagtcccaccctgacacctggc
ctccctgtcacgtcagatggggcacctgttccagagaaaaagaagaggtgtaggcgtaac
actgtcaatataggtattggggggttcatggttcgcagtagagttaggccacaggccaaa
cagcaggcagcttccacagatacagcgggcacattggaggagggacagtcgaaaccagag
ggagccactgaagtgacagataaaccgctagcagaaggagaaacacctgcagaagaaccc
aaaaagaaacggatccgtcgaactaagaaaaagagtgctcttgaagaaaacttcccaact
tatatgcaggaggcctttttcggcaaagatatgcttgacaagactaaaaccactagcaag
gagtctgtgaagattgattctgggtcggacttggacgaggcgaggacctcgccagtgacc
cttgacttcaggggagataaccaacccttgattaatcagggattactctccacatcccca
gtcaaggtcccttctagtagccacctgttgccctccgttggccaacctctcctgaatccc
cttggtgtccatgatgaattgcaagacagtgatttggacttgttaccggatgctctacca
caggatgacgaactactcagtattatcaacaaagaactagccaaagatcaggatgattta
ccaatgctcccaggagggacaatggaagtggaccctcgctcggaggaatcgagtcacaag
cctgaacttcaggcaaatctggatggtatcctcagtccaaatcttgatgatgagaaaaac
ctggatgttgacaaaattttatccgaaggactagtacacatggacagtaagactgtagaa
gacatcttcaaaggtgtgctggagaatgatcctcgaccgtcggttcctactgctccccaa
ggattcaacatgcccggccctaacccccacatcccaggaaaagaacagccccaacccccc
ggcatggatcccactcaggttcccatgaatcctggtatggggcaagggggtctggcaccc
ctggtcatgccaccacctccaggctttccctcaagtttcagcagtccaagttctatgagc
ccaggaggctttcctaacaaccagccgccatggcaacaggtgatggcccaggaggaggag
caacaagagcaggtgacgagtcgcaggaacatgcagaagtgggagtcagacgaggaactc
ggcgagcatgcaactatctcagcggttctctattgtaatctgaaacacccagaactacgt
cacgaacacccagattggcaagagcgggtgaagaagatcggcaagatttggaggcagcta
ccttcagatgataaacaaccttacctgcttcaagcaagaaaaaacagatcttctagtaaa
ggacagaaagcaagaaaggctaaacgggaacaggctgcagcagccgcagcagctatggga
ccacctcccatcccatcttactcacagcctactacaccggacggccttggctcgcccatg
tctggtatggccccgggacaggaaatctgtagccctctgagtcgcagcagcagcaactct
cagatcattgcaccaaagacaccagatggtcagtccccgagtcacatgatgggaggtgta
ccactgagtcccaatcaccaaggagtccagtccatgatgcacctccaggacccctatgcc
cagccactcgggactcccatgtctatggacatggctgggatgggccctcgaccgatgcgg
ccacagatacgaccgcaggatccctatgcccaggccccttccactccaagacctcatgtt
ccctttagtcaaccccgtccccaggggccttttcagcctggtatgaacatgcaacaaaga
ccacaagacctatatgtgcagcatccaggtgtacctcgtccaccaaatatgtactctcaa
catgaggcttcatcacgccctcctgggccatacaaccatccctcctcattaccccctgac
cagatcgggggacccttcagggggcccccgggacgagtgcctgatctattcaatcaagac
aacgatgcctacactcagcaaatgtcaacagccagaggttctgtgccaaccacacctcaa
cagtccccatcaaagtctcaatggcctggtatggcccaggaatctgacccatatgagcat
caagtcccaactccaagaccgatgatgcctattactgtggagggcatgtcctcgccctca
actccacagacaccaacatctcagccctttgatccattctcccagcacccttctgggccc
ccgcgttcaggacagcacccaggcatggccaaaccgatgatgtccagacaaacatctgta
ccgtctgacccatacgcacaccctccctccactccaggaggccctatgaatcgacctgat
gatccctatgctttttcacccccaacaccgcgccctgtgtcagaatcatatagtcctcgc
tctactggcaaggcagagctttctccccagcaggtaggccaccgccccattggtggggac
ccttacacacagatgataccaggaaaagggccaatgccaggtcagccagggccagagggg
tatctccagcatcccaacatgccaggaggtccacaacggtcaatgtctggcccccaagca
caacagatcccaccagcagactcctttgggatgcctttgcgccacccattccgggcccca
gttccaccaacatctcaagtgagaccacatggctatcaggagtctcatatgccacaaggg
ccacatcatcacggaagtatggagccacccaaggagccctctgtgttacagcagatgttc
gctgctgccagtagacgccacgcacaattccctttctccggaatgttttccacacttaag
cacaattatttgggtggcggtggaggtatggacaaacacattcacccgcagcaggtgaga
gatattctggctgaacagaccaagaaacggcagcaaaagaagatggagatgataaacaaa
cagatgtcggaggaaggagttccacccactggcctgccatctcctcatccaggtggtcca
ggtggtttctcgcctgaagaggggccacgcttccctagtcctggtggtcaaaatcctggg
atggacaggtgggcccacaaccagcagcagatggtgagacctccgcaggcaaggcagttc
aggcctccagatatggaaatgtttctgcgaggccagtttgaaggggcacggcctggtgta
cctggagtcatgagacagccccgccctcctgggccattatctccacacaaccagttctca
cccaggggctcttctcctcaaatgtcccctgtgccaggccagcatgcagtctataaacca
cagctactccagttggtgcaggagcgcattcgacccggacaacaacctaactctggcaag
ccacagcctcccacccccgggcctgccaccccaggggtacagcctccccctggttttgaa
cagtttagccccgctggtgacctgccaaagatgccgtttgaccccaacagacctccgagt
caaggacagccaatacctgcaggaattcccccggtacaacaacctcaagtgaaaactgaa
cagaaagaggccttaccagggaaaactgaggaggtttctgggcgagtgatgaagactcag
aaacaggtgatgtcatcagaagatgagaaacaagacacagaggacgagaatattagtgac
ctgctagacaatgatggctcatttgacattttgaagtatgccgaccccgagctggacttt
gacttggatgatcaaggcaaaagtatacttgatgaccttgtagaggaaagtaaggcagat
gattcagagtcagaggtcaagagtgaaatggacgcccccaggtccatcaaacctgaagag
aaagaagtgacagagactccggaatctataaagatggaggacgataaaacagaaacaggc
cccaagtctgtaacagccatgggagccgttgatttccaggctaagtttctggagttcagt
cagaggaagcaggaggagcgccatgcggatggtaccccaggtccctcggatcagaagccc
cctataacggaggcagacaaaaacaaaaacaagagtcagatagctgccattctacagaac
acagaccacatgcgtccacagttggagcggcgtgactctcagaagtcagatagtggatct
ttgggaaaagatctcctgccccgcaccccgtcagggacacccttaggtctgggtatggat
ctgtcccctatgggacaagctggcatgcaacttccatcacgtcccctttacagttcagga
atgccttcacctcttcaccagatggctcaagtgtatccaggttctcatacgcaaccctca
ccctcttcaacagcgggaaagtaccctcagcaaagtccgggaacaccaagcctaccctca
ccaaaggtcttaccatcacctaaaagcaacattccatctccaaggacacctaatgttcca
tcgccattcagtcagcaatctggtcttggtgggcagttgtctcccttctcacaagcagtt
caatccccattttctccaccagttacaacagcggctcattccccattcagcgcccctcct
gcgacatcgtctgccccccagtccccgtatggacccccagggaggactcaatcaccattc
accatccctgtgacagggagccccggcaacagccagtcgccttttggagccatgtcacag
ccgtcacccatgtctgcctcccaggcaccaggccagcggtcaccccgtggaaccatcacc
cccaccaaccagtacatgcaaggcacatatggtcagccaatgatgccagtaccccctagg
ggtgccaccactctccagcccactcctaacagcatcctttatggccagtcatctgctgcc
cagcagataagcaagggtcctactggaatgccaggacctcgaatgccgtttacctcacag
ggtatgcctcagcaagggccgccacagccaatggatcatcaacatcaacaacagcacatg
gagatgacctcacctggtggaacgcctctcatgaggatgccaagggtgtcgcttcccgag
ggagtcaccccagaacaagctatgcagtttcagaaccagcagcaggttcctgtttccatg
taccagggtaacatgcagggtcctcgcccccaaggtgttatgatgggagtgccagggccg
aatcagcctcctggtccccctggacacccaggcatgcgaatgcaagggatgagaccccct
acccctacagcaacatcaacctcccagtccaaggtccgactcttacaagaccagccccta
ctgatacaggacctgctcgatcaggtactggaaaagaaatccttggtcaatacgcagaaa
aacgtttttggttctggcacacgctcctggaatccagaacaggagaaacaagagcaacaa
agacaagcccagcagcaagcaatactacatcgccgtgacaacccaggtggcatggaagga
atgccaccgggtagtatgccacagggagttatgacaccaggaaatatgccaccaggaagc
atggtaccaggaagcatgccaccgggaggcatgccaccaggaagcatgccaccgggaagc
atgccacagggaggcatgccaccgggaagcatgccaccaggaagcatgactcagggaggc
atgccaccaggaagcatgccaccaggggcgatgcctccaggaggtataccacgtatggag
ggcatgcagcgtcccccaggttttccaatgcagggatatcgccccaggatggaacatcca
ggtgatccaaatcagtggccccgtatgtttggcccgtcagaaggcggtccacctcagcag
ggcaaaccaggctttcctccaggtgttaaccagggtgtacgcatgccagtacaacaaatg
aggcagtttgcccctggagtgccacctcaacaggggccagggcaagggccaggaccaaac
acagggggaccagggggaccagggggaccaggcattgctcctcccccaattccaccacca
gtaccacccatgcaaggtgagctgaatcctgagctggagcgccaacatctacagtacgag
gaatggctcgtcaaacaaagtcagtacctggaaatgcaggtcaaggccctggaacagcag
atcaataagtgcaagcgcaccaaaaaagcaatcaatgccagaggcagatctgccaagaaa
gcaaacaaagaggtacctattcaggacacacaggagctagagcgcgtcacacaggaacag
tctatgctccagaagcagctggaaggcctccgcaagcagttccgcacacatcaaatgcag
gctcaggagtacaggactaagaagagggaacggtttggcctaccagtccagcctcccgta
cctagccagccctcccctaccacaggggtgccagacacagtgatggtaggagcactccag
cctcgtatacctggggggccaggcacaatacgccttactgcatctgctcgtcaggaatat
gacaactacatgcagcaacgacttcgtcaacagcaacagcagcagcagcaacaacagata
ggagcgcgcccaccgctgcacacagtcgttgagtatacccagggaaaaacaacctcgaaa
aagaaaaaggctacaaaagtgtgcaaagccactactatccagaagaaagctaaggtacca
gtgacaaagagccccgtgtctatgtttaaattcaaatgtaaatgttgtttaatatgctgt
atgcacttgtgcttaaccggaattaagttcaggaaaacgagaaatatagagaaacatttt
tgtcgtttggaaattacactatggacaaatggccttaaattacagaagaaagctaaggta
cctgtagccaagagcccatcagctgacaataacccgttcagtgaagagtattacgagaga
gaacagatccagaaacaacatgagaggctacacatcgcacctggtcaacaggcaacaatg
gggcagcccccaagctctggtccaggcgatacccctgatgctaatcgtcagatgcaccag
ttctttggtggagaacgcccaccctttgaaggatcgggtccttacggtggacctaggatg
ccagctcctggggaacctagacctaggtttccaggggaacatggaccacggttcttaggg
gatcagggctcaaggtttccaggcgatcctaatcaggggccacggttcccaggggatcaa
ggacaacgttttcctggtgatccaaaccagggaccacggtttccaggggaacaaggacac
agatttccaggagatcaatcagctaggtttcctggtgaacaaggtcagaggtttgcaggc
ccaagattcatgtttgatcctcgtatgggtagtccaggagagcgaccaccgtacccagga
ccaaacccagccgcaatgaggatgcctggtatgcctggtatgcccggtatgcctggcggc
cccggaggtcccggtggccctgtaggccccggtggccccggaggccccggaggccctgga
ggacaagggggcatccctacctttcagtcaagctttggtctccctccctctgcaaatatg
caacaacagccttctgaggtgggctctgctggacaggaacagccaatggaaaaacctaaa
cccaaaaaacgaaagaagaaaaagaagcaacctgcagaaaatgctggttctactgcttct
accactccggccaatccaggtcctccaacagccgaggcgcgacctccgatccagttcacc
ccgcagtcagagactgagaaaaggataatggagatcctgaataatacagctaaaggcctg
gtcaaagctcagccttcagacaaacccgatacatttaagtcacaagattccagtaaatcc
ccagcatctgttgctagttctgacaaaaagcctgaaacctctcagccgaaagatgtcaca
gcgacatcacctgctggcagtgttgcaccatcccctgctggactaggtcaagtatctggc
cagacagtgcctcatccagggttgtcagtgcgaccacctggccctggagacatggccctt
ggtaagccagaaatgtacactaatcagcgaccgccaggtcttcctgggcaacagcaatta
ccacctccaccaccatcacaaccacagatgtctgctgcccatcaggagacccgtgtggag
gctgaggacagccatacagaaagtgagcctataatgccaatgaatgtgatgatccagcag
agcgtgccacagcgggttcagggtcccacagaatcacccgttacccttacacatcatgaa
ggtggcccgcctgggaaggagcctgagcctcactctggtattgccggcctacagtctgtg
gtacccaatgggacacctactgggccatacccatactccagtcagcaggccatattgggg
ttacctcctcacatggcccagataggacctatgacacaagggccacatggccacaatttg
caaaggcagggtgtgccaccacgaagtccacatatggccagtatgcaggaaagacagagt
ccccatcctggccaagacaggaaaagccctcatgcagctagtcatagtccacaccctgga
ggtatgcaggaaaggaaaagtcctcatgcagcaggtaagcctgcacatatggggattcca
ggcagccaccctgatcagcataccacacacatgcaggaaagtgtcagagtgtccgaaaga
aagagtccacacagtgcaggtcagtatttgggtatagtccatgatcatcacagtcctcga
cagagtcctgtgggtcaacactcagacaggcagagtccacgtcaagctttgcagggtggg
ccttacatggggatgacatatgatcacatcagcccacgacagagcccacatccaatcggt
caacacttggacagacagagcccaagacaaatgggacaagcaggaccatactcagacaga
cagggtccttatggagccatgatggaaaggcagagtccgcatgcacatgaaacacaaagt
ccaaatgctgcagggagtcctaggggaccaggggccgaacccagacaaattcaacaggat
aaatctgccagcagacagtctcagcaagcttctgcagaaaggatgtcacctagagcgcct
ggccctggatttccatatggaccatttcctcagatgggacctgggcctatgaggtaccaa
ggacccggtggaaaacctcattcttctgctcccactactcagccaggtacacaaggtcct
cctggctatatgggtccaaggggacctcctggccatcataggcaaatcagtcctggacca
gctggatccccaggccatgtaggacatcagggacttctgaactaccctagtccacgtggt
ccacgtccacagaactttcctcttttatcagagtcacagcttcgtatgatgaatcctcag
cagcacggctcacagccttctggagggatgcatggacaattacagcatcagcaggttcct
tcatcaagtggttctcccatatctagtcagccagcaaccttatcgacagaggatgataaa
aaacctggccaagattttagtgatagtgttcaatgtgggccacagcctccatctgaaaaa
tgtagtgacggtattcactgtgggaccccaccacctgaaaatccacaagtagtttgtagt
gacggtattcattgtgggaccccaccacccgaaaatccacaaggagtttgtagtgacggt
attcattgtgggacccctccacctgaaaatccacaaggagtttgtagtgacggtactcat
tgtgggaccccaccacctgaaaatcaacaaggagtttgtagcgacggtattcactgtggg
accccaccacctgaaaaaccacaaggagtttgtagtgacggtattcattgtgggacccca
ccgcctgaaaatcaacaaggagtttgtagtgacggaattcattgtgggaccccaccacca
gaaaatccacaaggagtttgtagtgatggtattcattgtgggacacctccacctgaaaat
tcacaaggagtttgttctgacggtattcattgtaggacacctccacctgaaaatccacaa
ggagtttgttctgacggtattcactgtgggaccccaccacctgtgaatcaacaaggagtt
tgttctgacggtattcattgtaggacccctccacctgaaaatccacaaggagtttgtagt
gacggtattcattgtgggaccccaccaccagaaaatccacaaggagtttgtagtgatggt
attcattgtgggacacctccacctgaaaattcacaaggagtttgttctgacggtattcat
tgtaggacacctccacctgaaaatccacaaggagtttgttctgacggtattcactgtggg
accccaccacctgaaaaaccacaaggagtttgtagtgacggtattcattgtgggacccca
ccacctgaaaatccacaaggagtttgcagtgatggtattcactgtgggaccccaccacct
aaaaatccacaaggagtttgtagtgacggtattcactgtgggacccctccacctgaaaag
ccacaaggattttgtagtgacggagtttgtagtgacggtattcattgtgggacccctcca
cctgaaaatccacaaggagtttgttctgacggtattcagtgtgggaccccaccacctgtg
aatcaacaaggagtttgttctgacggtattcactgtgggacacctccacctgaaaatcca
caaggattttgtagtgacggtattcactgtgggactccaccacctgtgaatcaacaagga
gtttgttctgacggtattcactgtgggaccccaccacctgaaaatcaacaaggagtttgt
agtgacggtattcactgtgggaccccaccacctgaaaatcaacaaggagtttgtagtgac
ggtattcactgtgggaccccaccacctgaaaatcaacaaggagtttgtagtgacggtatt
cactgtgggaccccaccacctgaaaatcaacaaggagtttgtagtgacggtattcactgt
gggaccccaccacctgaaaatcaacaaggagtttgtagtgacggtattcactgtgggacc
ccaccacctgaaaatcaacaaggagtttgtagtgacggtattcactgtgggaccccacca
cctgaaaatcaacaaggagtttgtagtgatggtattcattgtgggaccccaccacctgtg
aatccacaaggagtttgttctgacggtattcagtgtgggaccccaccacctgtgaatcaa
caaggagtttgtagcgacggtattcattgtggcaccccaccacctgtgaatcaacaagga
gtttgtagcgacggtattcactgtgggaccccaccacctgaaaatccacaaggagtttgt
agtgacggtattcattgtgggacacctccacctgaaaatccacaaggagtttgtaatgac
ggtattcattgtgggaccccaccacctgaaaatccacaaggagtttgtagtgacggtatt
cattgtgggacccctccacctgaaaatccacaaggagtttgtactgacggtattcattgt
gggaccccaccacctgaaaatccccaaggagtttgttctgacggtattcattgtgggacc
ccaccacctgaaaatcaacaaggagtttgttctgacggtattcattgtgggacacctcca
cctgagaaccaaaatggtgtttgtgcagacggtagaaactgtaacacacctccacctcca
tctcaaccagatacttccattgttacatcgaaccctcagagtgacagtactgaacaagtt
gaaaacaattctgaaccaatggacactggccctcctgttattccaaatgatcagcaccca
gtgccttttccaaatcaggtcaatcaaagtgaggttcagtcacaatgtcgatcgtcccca
atatctaaaaatgtccctgtcaacatattcaaaccaatcgctcctccaaatgtggccaca
accaatttgtctactgtcccggagcctattgttgtgaccactgtggtccatccagtctgt
ccgaccccaccttcaagtactggaccagtttgtaaggatgaggcggtaccttcacctcag
cctcctgttcctgtccttcccaggactgctcctttgtcctttatgggtcacgcttcatct
gatgtaccatctcatcatcagccccttgtgccttcgtcaggatctgctttcactggggaa
gtggtacctgtatccagacctacacacatcactccaaatactgctccagaaaactgtccc
acaacagacacagttacaaccatgacaacacagccaccagtttccagtcctgtcacattt
ggtggctcagcagaatctctttgtgccaacacacgtatagccactccatcatcatcaagt
attgctccagctccagtattacctgtgtcatccattgctccaccatcgacacacatacct
actctagtctccacctcctatcctgaggtaggcgataaaacaattccacctatatcaagt
cagagtgaagttgtcattccgtccactgatgcatacccacatgtcgccttaaattctgga
tctgaaccaaaattggtgcccacaccatcaacaagtcctagaggttctaagccagcccaa
ttgccacaaacagcagaaggtcccacagcacccctgatgcaacattcagataaaagtccc
attgcaattgatatacctctgtccacaccaaattctgtaccaagcaagatgcctgcatca
accgagggttttctggaagccaaattgcctacatcaacacatggatcacttgcatcacat
gcgcctccatgtacacaacatagtatcacgactatacctcagtctgcaccaggctctgtg
tcaatacatttaccccctgatgcaactccaggtgcctcggttaaacatgccatgccacat
cagcagcatgctgaaagacaccctggactcatgccatccatgccacaggcagctggtata
cctgctcacactccaggtatggcactatcttctgcatcctctgctctacagcaaatggct
agtgttgtgccaaccggcttcgctgcacctccaggcatccctcagacctctgctagtgac
actgtggagcagacgtcagtctcacatccaactgtgatggaattacaacaacaaacaatg
ttatcacaagcaatggctcactcgtcaatagccgcatccatcccgagctccactgcctta
tcaacaggactatcttcatctgtggcaggacctggtccacatcagcctccttttcaacac
atgtatcaaggaggccaaaagggtccaataccaagacagatgatgccatctgcatccatg
ccaggaccaaacacctccatagctgtctctaggcagggaggtcatccgagtatggtccca
acctaccccatggcacagggcatgcccaggatgcctccccacactagaatgggtatgatg
ggtcccgagcagagacccccacagatgtccatgatggggcctagaccataccctccacag
ggagcaaggccaccgccaggcctgcagcacatgccttcacaccaacgaatgaagatgcca
cctggctatccacagtaccacatgccacctcacatgcagaggatgccaccgccaatgttg
cgtccagagcagatgtcaacagatggtgcgccgatgtcatctcacatggggccacaaggg
atgatggaatccatgggagagcaatttcccccaggcactatgcccatgtcaacaatggcc
agccaccaacatttgtcacacccaccttattccaacacttctccaggggccccacagtta
gtcgcttccaatcaccaaatggagaatatgatgcgaatgagacatccacagtatcctatg
ggaccaggctttcctcaaagaatgcctcctcacatggtaggaatgccacctggctccgga
ggtaatccacctggtggacagagattccaggatcacatggtagctatggccaataagatg
tcgtcgcctcaaggttcagaggcagggcctcatccaccctatatgggtgtgcactctcaa
atgcaggatcatgcaggccttccaggagtactgatgacagccctgtccactgtacccatc
acaacactgacaccttcactgccggtctctctttcatctatctcgggaccaaattgtaca
cctcctatgccacacccgagcccgtcaccatcttgtacaccttccaggacaccgtctcgt
gccagctccaacccaagtccacagtctggcattcacattcacacgcctacatcaccaatg
atcaagaatgagttgatgatgagtggtcctgagggtctagctcgacagctgtctggggag
atacgcatcaaagaagaacccatggacatctcccagaaactccctggtatgcttactgag
gaagatgacctcaagatccgacagaatgccatcctaaagcagcttctgggcaccgcggga
atgaatgcattcaagaaacagatgctacctggatcagctgatgggggaactatggaatcc
gaagatggctcacctgtacagctgacacctgaacagcagcgacagctggaaatgatcgag
cagatgccactgttgaaggaggcagagatctctgctgaagagtgggacatcaaaacacct
gaggaaaaagaaaaaatactagagggtcttgtccttgcagaaatgaggaaacaagagtat
gaagccaagaggaaggagtttgaggagacacgaaaagccaagcgcaaaacaggagaaaca
agaaagaggaagaagaagaaacagcaggagcagcaagcccaggagactccagctggagaa
gaggaacaggcgatgatgcctgctccagtgccacctattgtagagggtcaaggtcctccc
ccagtcaccactcctcctgtactgccagtccccacacagcctcagccaaagaaaaggcaa
aggaagagcaaggccaagaatgctgatccttcaaaggacaaagacaaggatgggaagctg
gagagtttctacagcagcctgaattcactaccagtcgtgcccctgcaggagcctcgtgtt
ggcagttttttttctatcagccctgtgcatggtagtgctgccttgttgacaggtgaaaat
caactaaaaggaacttttggtgcctcgtaccttgaaggtgttgccgattactatggcagt
actctcttggttggattacctcccttagagtcatttgtgggtttgtctcggccacgcgac
atagaaacacgaaggaaatacatcactgacggtcatgatcggccagtagttggatctcag
tcggactcccagaggtaccaactgtctcagaaccaggagattcagaataggttcatgatg
cagggccaccctacacaacagtcgcctcagtatcagaaccatgctatgtttggggcccag
atgatagggccacgggataaacccgtcccacccactctccctcctcctcccaggattgaa
cccagattggatctagtgtcaagaggaagtgatagtccagaaactgtgatatcgtcgtcg
tctccagagcatggattcggtgaagtggaggaggaatatcccatgttgcgtcccatcgac
cccgcacccattgacgaccgagcatcaccttcaatgcctttggtacaacctgttgtggtt
aaggcgtcgcccatcagacccaaatctactgactcacactttgagattccagagaaaaca
tacggtcatcctcgaccattaatagacagtgatgtattggacaggaaatggggctatgat
ccaatgtcaatatctggcaaggaaaacgacctgacacagagtctgacatcttctcttacc
aagcctttccgggatgctgatctcaagcaggacatatccgtgaccgtgactttgtctgca
aaatctgcagatgatattggtggtgtgttgtcaacaatagcagaacttttaaagattgct
gtgccaccaacatacgaaatgagcagaagtccctcaccagacacctacaaatctgtcacc
aaacacaaggagcaggctgtgaacatacactccctcatcaaagccaagcccaagttctgt
cgccattgtcagacggtggtgatggagggtggagtgagaaagcgacgctcagagattcca
tgcctcaagaaggaggaccagtttacattcaaggatatcgaggatgaggaggtgacattc
tgtacgtccgactgctgtagccagtacatagctatctgtcagatgatacagccaccaccc
aaactagtggagcctaaggaggagatccttgaacctcctccccagcccacaacactggtc
agcccagtgaagaccttcgacctgtcaagccccctgactgatacttccacattatctggt
aatgaggcacttcctgtgccctccaccccatcaactcctacctcttcgggggtgtccact
cccacagtcactccaaccacacctgtgaggcagaagtcggaggaaaaactgcagaagaaa
ctgaagcgaagtaacagctactatgacaagcctcttgagaagaagtggaaaggaaagcgg
tacaagtatgttctaaatgaagtagtggagagcctaggtgtggcaccaggcatgccggag
atagaggttgatgtgttatggaaggccctagggaccataatcatcccagaccccctacca
aaggacaacagggtctgtgccttctgtcaattcgggggagatgaggtctcggacggccca
ggcaggatgcttaacatggatgttgacaagtatatccatctgaactgtgccctatggtca
tccgaagtgtacgagacactgaacggtgcgctgatgaacgtagatatggcttacacccgt
ggtctacggacggagtgtgtcgtctgtaaaaacgttggggctacattggaatgcttcaaa
tcccgatgtggcaattattatcatgttgggtgtgccaacaaacagggctgcatgttcttc
caggataagacgttactgtgtcctggtcatgcacccaagcttgccccagataatgtactg
gaatccctggtggtacatcgccgtgtttacatcaaccgtgacgaggacaaacaagtggcc
agtatggtccatcgccaacaggaaggtaacttcaccctgagggtgggctcactcatcctg
catagcataggacatctgatgccttaccaaatagtcagtgctaaataccacactcgcgac
tacatctatccagtcggctataaatctagtcgtttttactggagtatgcgtcggctttac
aaacgatgtcgatatgtgtgcagcgtctatgagaatgaaggtcaggcaggatttaaaatc
caagtggtagagcgaggtttcgaggacctggtgatggaggataacacacctcgtggtgtc
tggtccaaggtcctagagccacttgacaagatgagaaaaaacgcagatcttgtaaagatc
ttccccaactttatcacgggtgaagaactgtttggtcttacagagcccaccattatcagg
gtcctggagtcgctccccggaactgaccagctcactaactatcactttaagtttggtcgg
tcatcacttattgacatgcccctcctgatcaacccaacaggctgtgccagaactgagccg
aaaatgcgcacccacttcagaagaccccacactctacagtctagcaacacctcgcgttcc
ctgcccacaactgttacgggggtgactggtgacctcaactccccatacatgaaacagttt
gttcactctaagtcccaacagtacagacgcctcaagactgagtggaaaaacaacgtgtac
cttgggcgctccaggatccagggcctaggattgtttgctgccaaggatacagagaagcat
accatggtgattgagtatattggagaccttatccgtaacgaggtggccaatcgtcgagag
gtgatctacgaggagcagaatcgtggagtgtacatgttccgcattgacaatgaggtggta
gtggatgccactatggctgggggccctgcccgctacatcaaccattcctgcaaccccaac
tgtgtggcggaggtggtggccttcgacaaggagagcaagatcatcatcataaccaaccgc
aaactcgccaagggcgaggagttgacgtatgactacaagtttgactttgaggatgagcag
cacaagatcccttgctgctgtggagcaccaaactgtcggaagtggatgaattaa

DBGET integrated database retrieval system