KEGG   Mizuhopecten yessoensis (Yesso scallop): 110462591Help
Entry
110462591         CDS       T05079                                 

Definition
(RefSeq) putative neurotrophin receptor LTRK 1
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Brite
KEGG Orthology (KO) [BR:myi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myi01001]
    110462591
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:myi04090]
    110462591
Enzymes [BR:myi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110462591
Protein kinases [BR:myi01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   110462591
CD molecules [BR:myi04090]
 Proteins
  110462591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Pkinase_fungal Pro-kuma_activ Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 110462591
NCBI-ProteinID: XP_021372277
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MQLKHNSMAILKIFQWYYVTYFTLSLHFFSIGADMENVLQIPTSVYVEEAKSYNTSLNKF
ERLVGKTILDVQYQFWFNVRQRQIQQPSTEEKVTDIQIVQEQTGPMAIHLVSTCNDTDVD
RKTKSGNALLPVSIELETDVCLGTILSGNESSNVSVAFASTRLWERFASVLWNNEDMNIT
DISFVTLISSGGFDDRRTVTYPEAVTDLHITVSDPSLYSTQGVEWQFSASNVTYETREQC
SSACSKDLEPDGRVIYFNGTSLDITSPRIIGSYWRCVLKVKFYLRDQDIALILNVIQDQN
VWTHRVKTTNRWTEYIVPIGQINGIFKVQIQFYRIKQIRWKRGKLQNAVFENCDLSSVHS
EKQEPGLSKDTFVCRTGVIIRSDQLCDFHDNCFHGDDESEEICGNGFSLGLCDFEEITNC
SLILRDYMESTSTVEDANVTVALTDGTGSLKGHVLAFEERQNAKKTGFVTVNLTQPESYL
ANNKSCVFQVDTYSTVNGGRFRLIVHIIDAETEEILKKDETNLPLYEWQIYRQLIPDFSE
RNVSTFYLVVYTVLSNGYFLGFDNIYISSECIAKDTPATFSREIPEESNVVMIVTVSCAS
MGFVWISILLLMYMRYTKIPQTGKSRKRLSLFGARSRSVKGVPDSAPLLRRLNENLWQDH
PNYHMYKQILTQDLSDDIKNLSRYKLKLTKVLGSGAFGEVLQGQLIRGVIFKHVAVKRLS
SGCSEKERTDFLVEALTMSKFKHDNIVCCLGIYVKNGALLLVEELMAGGDLKHFLVESRP
TIDETPALSTDELLSLANDICQACSYLEAHKFIHRDIASRNCLLTAKTPDRVAKMADFGL
ARDIIQNDSYQKCGRSMLPVRWLPPESYLEGIFSTKSDVWAYGILLWEIFSFGYDPYPSM
KCEEMMAKVNGGQRMAAPSRCPTVVYDVMMLCWQHDPKSRPSFERLCEYLQKIRKNVCIN
IVCTNDVSGDEQGDDRVESDEENKLHTWHCNGNYAIEEESV
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgaaacataactccatggctatattgaagatatttcaatggtattacgtcacc
tattttacactgtctttacattttttctccattggagcggacatggagaatgtactacag
ataccaacatctgtttacgtggaagaagcaaaatcatacaatacctcacttaacaaattt
gaacggcttgttggaaaaacaattttggatgtccaataccaattttggtttaatgttcgc
caaagacaaatacagcaaccctctaccgaagaaaaagtaacagatatacaaattgtacaa
gagcagaccggaccaatggctattcatttagtatctacatgtaatgatactgatgttgat
cgtaagacgaaatcaggaaatgctttactgcctgttagcatcgagttggaaacagacgtc
tgtctaggtactatactatcaggtaacgaatccagcaacgtttctgtggcttttgcctct
accagactttgggaaagatttgcctccgtgttatggaataatgaagacatgaacataaca
gacatctcctttgtaacgttaatatcgtctggaggatttgacgacagacgtacagtgacg
tatccggaagcagtgacggacctgcatataacggtttccgatccgtcgctttacagtaca
caaggagtggaatggcaattctcagcgtcaaacgtgacctatgaaacaagagaacaatgt
tcatcagcctgctcaaaggaccttgaacctgatggccgggtcatctatttcaacggtacc
agtttagatattacatctccaaggattattgggagttactggcgctgtgtacttaaagtg
aaattttatctccgagaccaagacattgcccttatactgaatgtcatacaggatcaaaat
gtgtggacacatcgcgtcaaaacaacgaacaggtggacagaatacattgttcctatcgga
caaatcaacggaatcttcaaagtgcagatacagttttacagaataaagcagatacgttgg
aaaagaggaaaattacagaatgctgtatttgaaaattgcgatctgtcatcagtacattcg
gagaaacaagaacctggccttagtaaggatacatttgtgtgcaggacaggagttataatc
aggtctgaccaactgtgtgatttccatgacaactgtttccatggtgatgacgaaagtgaa
gaaatctgtggaaatggattttcacttggactttgcgatttcgaagagatcaccaactgc
tccttgatcttaagagattacatggagagcacgtcgacagtcgaggacgctaatgttaca
gtggccttaacagacggtaccggctcattgaaaggtcacgtcttggcttttgaagagcgt
cagaatgccaaaaaaacagggtttgtgactgttaatttgacccagcccgaaagttatttg
gccaacaataaatcatgtgtgtttcaggtagatacatactcgacagtaaatggtgggcgt
ttccgtttgattgttcacataatcgatgctgagactgaggagatcctaaaaaaggacgaa
acaaatttaccattgtacgagtggcaaatataccggcaattaattccggatttttctgaa
cgaaatgtctccacattctacctggtcgtttacactgtgctttcaaacgggtatttcctg
ggattcgacaacatctatatatcatccgaatgtatcgcaaaggatacgccggcgacgttc
tcaagagaaatcccagaggagagcaacgtggtcatgatagtaacagttagctgtgcatca
atggggttcgtgtggatttcgatattgctcctaatgtacatgagatacaccaaaatacct
caaactgggaagtcgaggaaaagactttcacttttcggagcgcgatcgagatcagtaaag
ggtgtgccagattccgctcccttgttgaggcgactgaatgagaacctttggcaggatcac
ccgaactatcacatgtataaacagatactgacccaggatctcagcgacgacatcaagaat
ctatccagatacaaactcaagttgaccaaagtgctaggaagtggtgcgttcggagaggtg
ctgcaaggacagcttatcagaggagtcattttcaaacacgtggcagtaaagagattatca
agcggttgttcagagaaagaaagaacggattttcttgttgaagcattaactatgagtaaa
ttcaaacacgacaatatcgtctgctgtctgggaatatatgtcaagaacggtgccctccta
ctggtggaggagctgatggcagggggtgatctgaaacatttccttgtcgagtcacgtccg
accatagatgaaactccagccttgagtaccgacgaacttctctctttagcaaatgacatc
tgccaagcgtgtagttatctggaagcacataaattcatacacagggatattgcctcccgc
aactgtctacttactgcaaaaaccccggacagagtggcaaaaatggcggactttggctta
gcccgagacattatacagaacgactcctaccagaagtgtggacggtctatgctgcctgtc
cgatggcttcctccagagtcctaccttgagggaatatttagcacaaagtcggacgtttgg
gcgtacggtatcctgttatgggagatcttctccttcgggtatgatccctatccgtcaatg
aagtgcgaagaaatgatggcgaaagtcaacggaggtcaacgaatggcagctccatctcga
tgtcctacggtcgtctatgatgtaatgatgctctgttggcaacatgaccccaaatcacga
ccttcctttgaacgactatgtgaatatctccagaagattaggaagaatgtgtgcatcaat
atcgtctgtactaatgatgtaagtggcgatgaacaaggggacgacagagtcgaaagtgac
gaggaaaacaagcttcatacctggcattgcaacggaaactacgctatagaagaggaatcg
gtgtag

DBGET integrated database retrieval system