KEGG   Mizuhopecten yessoensis (Yesso scallop): 110464394
Entry
110464394         CDS       T05079                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:myi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110464394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myi03000]
    110464394
Transcription factors [BR:myi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110464394
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf UPF0242 MCU DUF724 ssDNA_DBD V_ATPase_I FapA YabA
Other DBs
NCBI-GeneID: 110464394
NCBI-ProteinID: XP_021375263
LinkDB
Position
Unknown
AA seq 636 aa
MSLNMVSEVDRRFYSNNLLSNEDLESDMDLSEILGMDAALNPEDLVRNFPDDFPTLTLDA
INNDTFAVFPDSVNIFSDDLQQEFSDSSDSGISGVTVQYENQPSPDLLIKQEPPSPASSL
SSEGSDGTVSQSHKTYTADFDLKIESPPLSPQSMILSGQGHNITQASFTYINDQSELGSQ
VIINAPTQPCSTVLTGFDTSININSILNSKVKIQPKPLSTDKTTTVQKPAFPNTEPGKPL
VLTPEEFKRLTSQGVLKFQPPCTNQKNKAEIPKVTTTVISPPQIKMAGSPIVQVDHEMKN
VKRQQRMIKNRESASLSRKRKKEYLQTLEEQLSDYDQQNQKLQQENEELRRRLSTMQTEN
EVLKRRGTGMASPTKKICLMAVFVLFSLNLGTFSDLIFTPHITRRNSNPSPDMFPHKGRQ
LLAVTEEKDTYSVGSFMPDYPFSRLKKFMEENPQHAKEINNDTLYQLYTCPSYFNKTESI
RLADQLSGWMKRHEQQKKKKPRKPANKGRRPITSSHSLRELRHLREEQYRSRENQLQLFQ
NDTVRNFWQSLPRRNDTFYVLSFNSDYFLIPAVAHNKTMRPRMSLVMPATSLNETMQPPA
GNIGMMQIDCEVLNTQLIHVHKSALPRHNTSESFFP
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgagtttgaatatggtctcggaagtggacaggaggttctactccaacaatctgctttca
aatgaagatttagagtctgacatggacttgtcagaaatactgggaatggatgcagcactt
aatccagaagacttggtccgcaatttccctgatgactttccaacactgaccctggacgcc
ataaataacgacacatttgcagtgtttcccgattcagttaacatattcagtgatgatttg
cagcaggagttcagtgacagctccgacagtggaattagtggtgtgacagtgcaatatgaa
aatcaaccgtcaccagaccttttgatcaagcaggaacctccgtctccagcttcgtccctg
tcctcagagggctctgacgggacagtatcacagtcacataaaacatacacagcagatttt
gacctgaagatagaaagtccaccattgtcaccacagtccatgatcctatcagggcagggt
cataacattacacaggcgtccttcacatacatcaacgaccaatcagagctggggtcacag
gtcatcatcaatgcaccaacacaaccttgtagcactgtgctgactgggtttgatacatct
atcaatataaactcaattctaaattccaaagtcaagatccaaccgaaaccactatcaaca
gataaaactaccactgtacaaaaaccagctttcccaaacacagaacctgggaaaccatta
gtgcttacacctgaggaatttaagaggcttacttcccaaggagttcttaaattccagccg
ccctgtacaaaccagaaaaacaaggcggagattcccaaagttacaaccacagttatctcc
cctcctcaaatcaagatggctgggagtccaatagtgcaggtggaccacgagatgaaaaat
gtgaaaagacagcagaggatgataaaaaacagagaatctgccagtttgtcaaggaaacgc
aaaaaagaatatctacagacattggaggaacaactaagtgattatgatcaacagaatcaa
aaactgcagcaagaaaatgaggagttgagacgaagactctctacgatgcaaacagagaat
gaggtactgaagagacgaggtactggaatggcctcccctaccaagaagatctgcctcatg
gcagtgtttgttttattctcactcaatcttggtacatttagtgatctgatatttactcct
catattacaagacgtaactccaatcctagtccagacatgtttcctcacaagggaagacaa
ctcctggctgtaacagaagaaaaagacacatattcagttggaagcttcatgccagattat
ccatttagtagactaaaaaaattcatggaagaaaatcctcaacacgccaaggaaatcaac
aacgataccctttatcagttatacacttgtccatcatactttaacaaaacagagtcaatc
agacttgcagaccagctctctggatggatgaaacgccatgaacaacagaaaaagaagaaa
ccaagaaagccagctaacaaagggagacgacccatcacatcctcgcactcactaagggag
ctccgtcacctgagagaagagcaatataggtctcgggaaaaccagctacagctgttccag
aatgacactgtgagaaatttctggcagtcccttccgcgacgcaacgacaccttctatgtt
ctctcgttcaactcggattacttcctgataccagcagtagcacacaataaaactatgaga
ccaagaatgtcactagtgatgccagcaactagtctcaatgaaaccatgcagcctccagct
gggaacattggcatgatgcagatcgattgtgaagtcctcaacacccagctgatccatgtc
cacaagtccgctctacccagacataacacatcagaatctttcttcccttga

DBGET integrated database retrieval system