KEGG   Mizuhopecten yessoensis (Yesso scallop): 110465685Help
Entry
110465685         CDS       T05079                                 

Definition
(RefSeq) glutathione S-transferase U26-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00480  Glutathione metabolism
myi00980  Metabolism of xenobiotics by cytochrome P450
myi00982  Drug metabolism - cytochrome P450
myi00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110465685
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110465685
   00982 Drug metabolism - cytochrome P450
    110465685
   00983 Drug metabolism - other enzymes
    110465685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:myi02000]
    110465685
Enzymes [BR:myi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110465685
Transporters [BR:myi02000]
 Other Transporters
  Pores ion channels [TC:1]
   110465685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_5 GST_C_2 GST_C Glutaredoxin Fer4_5
Motif
Other DBs
NCBI-GeneID: 110465685
NCBI-ProteinID: XP_021377342
LinkDB All DBs
Position
Unknown
AA seq 235 aa AA seqDB search
MSKVKLYCAWFCPFAQRAWIAFLEKGLPFEYVENNPYEKTPELIAVNPNGLVPVIVLEGG
RSVFESSVCIEYVDELDQEGKQILPRDPYERAQVRMWSEFINKKIIPPFYQMLAAQEKEK
QEKIKLALLEHLATFSATIDDSGPFFSGKSFGMVDMMLCPFSLRFGPVLKHFRDFEVPNT
DRYRKFHKWMDACHTHPSVVPTIADDRKITAVYRYYAENMPMSDTADAVKRISGL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtaaaactgtactgtgcctggttctgtccctttgcgcagagagcgtggata
gcttttctggagaagggactgccttttgagtacgtggagaacaacccgtatgagaagact
ccagagctgatagcggtaaatcctaacggtctagtaccggtaattgtactggagggcggt
cgctctgtgttcgagtccagcgtttgtatagagtacgtggacgaactcgaccaggaagga
aaacagatcctaccacgtgacccgtacgaaagggcacaggtcaggatgtggagcgaattc
attaacaaaaaaataattccaccattttaccagatgttggctgcccaagaaaaggaaaaa
caagaaaagattaagctggcccttttggaacatttagcaacattttctgccaccattgac
gatagcggtccgtttttcagtggtaaatcgtttggtatggtggacatgatgctgtgtcca
tttagtctccgcttcggtcccgtgttgaagcatttccgcgactttgaagttccaaacacc
gatcggtaccggaaattccataagtggatggatgcctgccatacacatccaagtgtcgtg
cccaccattgctgatgaccgcaagatcacggcagtatacagatactacgccgaaaacatg
cccatgagtgatacagcagacgccgtcaaaaggatcagcggactttag

DBGET integrated database retrieval system