KEGG   Mizuhopecten yessoensis (Yesso scallop): 110466703Help
Entry
110466703         CDS       T05079                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00052  Galactose metabolism
myi00500  Starch and sucrose metabolism
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110466703
   00500 Starch and sucrose metabolism
    110466703
Enzymes [BR:myi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     110466703
    3.2.1.20  alpha-glucosidase
     110466703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110 Trefoil
Motif
Other DBs
NCBI-GeneID: 110466703
NCBI-ProteinID: XP_021379075
LinkDB All DBs
Position
Unknown
AA seq 2753 aa AA seqDB search
MVDCSKKRVAIIAVVVIVLAAIITPIAYFVTKEDKRKKVDTPAVVPPVAHAPRRLADRIN
CIPESDGNVVTITQDLCESRYCDFIPATTAWNAACVFPARKEYGFSVNGSVQITIMGWKV
YLKQKGMHAFNSTPFRRPYFEVQMPDENLIRFKFDDENGNRFHVPFNLEIPDKQPSKMAY
ELKITDKENFAFQITRKSSGAVLFNTSIGGLTLTNQFLQLSTTLPSENVYGFGENIHESF
RHDLNYRSWPMFSRDQPPFHKKKSNLYGVHPFYTCVEADGNTHGVLLLNSNAQDYSFTPL
PTLTYRTIGGILDFYMFLGPSPENVVQQYTQAIGRPFMPPYWSLGFQLCRYGYNSLENMI
AAVNRTRDYGIPHDVQYADIDHMNNSKDFTVNNVDFAGLNDSFTALRNGGMRTVIMLDPC
FVSNVSGYEPYDRLSQIRGGVMWHGGVENDTKDVTGAILGYVWPNGKVVFPDFFKNSTRQ
LWKSLVKEHRKRLIFDGLWIDMNEPANFGTNQDRPFNWNENVKPHWSLKCPRSQYDDPPY
RTMAAYVHDGDDYKDAAARLSNKTLCMVATQGDTDDLLHYNVHSLFGWRQSPPTISALRE
ASGERSMVLSRNTFPGSGKYVGHWLGDNDSAWPGLASSIIGMLEFNLFGIPYIGADICGF
FGDTTVELCKRWMQLGAFYPFSRNHNTIDSTVEQDPGALGVEVATAAREALETRYWLLPY
LYTLFHNAHVHGSTVVRPVHHEFPMDDVALGIDRQFLWGKSLLISPILEQGQTELTYYVP
EGRWYDFYKPGIFVEGPHLNKVAVDSNSPISLHVRGGSILPMQEPARNTTYSRLNAMKLL
VALDRPDEEGGSATGELFWDDGASIDTYENGNYTLTQFRAENQTLSMYISEGQREWANSL
VLDTVQVFGVTTHVHNILIQTSNKYHSNFTYDATQKVLDIRNLKLPLNTDFKLTWHDGTN
RIDCYPERLGGQLEATEERCSKRKCLFHPTDSDAPDCYFPPDYGYTAGDEMQTATGWTVN
LTWKGKAPFPNPISKVTFAVEMLDNAILRFKLYDPSNSRYEVPMKMNIPTPVRRPADPRY
DIIMTSKNPFHFQVKRKSTGTILWDTSVGGLTFEDQFLQIASRLPSRNVYGFGENVHTTL
KHDLDWTMWPMFARDQPPGSGKNPRDAKNLYGVHPFYTCMEEDGHSHGVLLLNSNSQDYA
FTPLPMLIYRTIGGILDFYMFLGPEPENVIQQYTGAIGRPMMPPYWALGFQLCRYGYNNI
SNLQAAVERTVSAKIPFDVQYGDIDHMEERKDFTIDRGNFSGLKEYFNELRDNGMRTIII
LDPCLLADKTYAPYQKMSEQDGLIKWPMSYTVPNGSSDENGALLGYVWPSGKVVFPDFFK
NSTRDVWIGLITNHSTEISFDGLWIDMNEPANFGTNEERPWNWPANTTAWSLKCKVGDTY
EDPPYRSMAAFQSDDGNRLHRISEKTICMVARQGKDNSYLHYDVHSLYGWSQSKPTLDGL
QMAQSGKRGLVISRSTFPGSGQYAGHWLGDNSADWDHLRLSIIGILEFNLFGIPYIGADI
CGFFGEPSAELCKRWMQLGAFYTFSRNHNTLGQPDQDPAVFSESVTKASREAMETRYWLL
PYLYTLFHHTHIRGNTVIRPLHHEFPTDSATYGIDRQFLWGPALLISPILEEGLTEVRVY
LPHGTWYDFYTGATFEGKQHITVEVNQDSKIPLHTRGGYVIPMQAPANTTVYSRKNAFSI
TVALASDGKRTSAEGDIYFDDGESIDSYESGNYGTAKFIASERGLKMRVGHTYSSTEEAF
IIGEICVLGIRENITMVYINSSLQHLDIHHYKTNNTLVISNLSLSLTEEFYIEWLTERKL
ERDELERINCYPDMDDTFSTKNKEECRLRGCIWQDASHKNIPPCHINKTQHGYFQSKLEV
LSNYFDGIVLEWKNQTQFFGGNIPYVELQVHNISENILRLKYMDLAYRRYEVPVQLNTTI
SRQKQDNDYRVEFSENSHGSFFVRVIRQSTNTTIWDTSLGGFTFAEQFLQMVVKLPSKNM
YGFGENRHFSFQHDFEFKRWPMFSRDNGVNWGDFANLYGVHPFYLNIEDFSGNSHGVLLL
NSNAMEIELNPLPSLTYRTIGGILDFYIFLGPTPEQVIQQYTSVIGHPYLPPYWSLGFQL
CRYGYNSLQAMKEAVDRTKSADIPQDVQYADIDHMDERRDFTVDDVNFGGLQKYFKELQN
EGMHTIIILDPALITNVTDYLPYNEGVKKDIFIKWPNVDSSPDYQEFNRTDMLGYVWPQG
KVVFPDFLNPATRDYWRDLIVNHHKNLSFDGLWIDMNEPANFGTNEEHPWNWDENSKPYW
SLNCPTSRWDDPPYKPKAIFGSRLSDKTLCMVAVQNEARHMHYDVHSLYGWSQTEPTLHA
LREATSERGIVISRSTYPSSGRYAGHWLGDNDSAWSDLHDSVIGLLEFNLFGIPYIGADI
CGFFKNSTSELCERWMQLGAFYTFSRNHNTINTAPQDPAYFGPAVASSSRKALIVRYTLL
PYLYTLFYHVHVHGGTVIKSLTHNFPNDQTTWSVDTQFMWGKAFMIAPVLQQGKTQVDVY
FPVGRWFDYYTGQEVKSSSSFEVVSAPRDVIPLFVYGGHILPTQLAANTTVYSRRNPMGL
FVVLNENETAKGDLFWDDGKSIDTVENHEYFLLSFSFKSNNLSMTVDQKPLNTDDFANNL
IIKNVTIYGKTVWNSVKVNNASHDDFISDTRLNVFRVTNLNLAIKNDFLISFL
NT seq 8262 nt NT seq  +upstreamnt  +downstreamnt
atggtggattgtagcaagaagcgggttgctattatagcagtagttgtgatcgttttagct
gctattataacacccatagcttattttgtgacaaaagaggacaaacgcaagaaggttgat
acgcctgctgtcgttcctcctgtagcacatgcgcctcgtcgactggcggacaggatcaac
tgcatcccagagagtgatggaaacgttgtaacgataacacaagacctgtgcgaaagtaga
tactgcgattttattcctgcaaccacagcatggaatgctgcttgtgtgtttccagctcgg
aaggagtacggattttctgttaatggaagtgtacaaatcactataatgggatggaaggtc
tatctcaagcagaaagggatgcatgcattcaacagcacaccatttcgaagaccgtacttt
gaggttcagatgcctgacgaaaatctcattcgattcaagtttgatgatgaaaacggcaac
agatttcacgtcccattcaatctagaaattccagataaacaaccaagcaagatggcttac
gaactgaagattacagacaaagaaaacttcgccttccaaattacccggaagtcatcagga
gctgttttgttcaacacgtctatcggaggcctgactttaacgaaccagttcctacagctt
tctacaacattgccctcggaaaatgtgtacggatttggagaaaacattcacgagtctttt
cgtcacgatctcaactatcgctcatggccaatgttctcgcgggaccagccccctttccac
aagaaaaaatcaaacctgtacggtgtacatccattctacacgtgcgtggaggcggacggc
aacactcatggggttctacttctcaacagcaacgcacaagattactcgtttacaccccta
ccaacgttgacctacaggacgatagggggcatactagacttctacatgtttcttggaccc
tccccagagaatgttgtccagcagtacacacaggcgattgggagaccttttatgccgcca
tattggtcattaggattccagctctgtcgctatggttacaatagtttagagaatatgata
gctgccgtcaacagaacacgggattatgggattcctcatgatgtacaatacgccgatatt
gaccacatgaataactccaaggatttcaccgtcaacaacgtggatttcgccggtttgaat
gattcattcactgctctcagaaatgggggaatgcggacggttatcatgttggacccgtgt
tttgtcagtaatgtgagcggctacgaaccatatgatcgtcttagtcagatcagaggagga
gtgatgtggcatggtggagtggagaacgataccaaagacgtcactggagcgatccttggt
tacgtatggccgaacggaaaagttgtgtttccagactttttcaagaattcaactcgtcag
ctttggaaatctcttgtgaaagaacataggaaacgattgatcttcgacggcttgtggatt
gatatgaacgaaccagcaaattttggtacgaatcaggataggccgttcaactggaacgaa
aacgtcaagccgcactggtcactgaaatgtccccggagtcaatacgatgatccaccatat
cgaacaatggctgcatacgtccacgacggagacgactataaggacgctgccgcccgtttg
tcaaataagacactgtgtatggtggctacacagggtgatactgacgacttactacattac
aatgttcacagtctgttcgggtggaggcagtccccacccacaatcagtgcgttgcgggaa
gccagtggtgagcgtagcatggtactgtcgcggaatacattcccaggaagtggcaagtat
gtgggacattggctaggggacaatgacagcgcatggccgggtttggcatcatccatcatc
ggcatgctggagttcaatttgtttgggattccatacattggagcagacatatgcggcttc
tttggtgacactacggtagagttatgtaaacgatggatgcagcttggagcgttttaccct
ttctccaggaaccacaacacaatcgattctactgtagaacaggatccgggcgcattagga
gtggaggtcgcaacggcagcacgtgaagccctagagacacgttactggctccttccctac
ttgtacacattgttccacaacgcgcacgtacatggaagcacagtagtcagacctgtacat
cacgagtttccaatggatgacgtagctcttggaattgaccggcaattcttgtgggggaag
tctctcctcatctcacctatattagaacagggacagacggaactgacgtattatgtaccg
gaaggccgatggtacgacttttacaagccagggatctttgtggaaggaccacatttgaac
aaagtagcagttgactccaattcaccaatatctcttcacgttcgtggtggaagtattctc
cccatgcaggaaccagcacgaaacaccacatacagtcgactgaatgcgatgaagttactg
gttgctctagacagacccgacgaggaaggaggatcagccactggtgaactgttctgggac
gacggagcttccatcgatacatatgaaaacggaaactacacattgacgcagttccgtgct
gaaaatcaaactttgtcgatgtacatatctgagggacaacgagagtgggctaatagcctg
gtactggacactgtccaagtctttggcgtgactactcatgtgcacaacatccttatacaa
acctccaacaaataccactccaactttacgtacgacgccacacaaaaggttctggatata
aggaatctgaagctgccgctaaacactgattttaagttaacttggcatgatggtactaat
aggattgactgctatccggaacgtctcggaggtcaacttgaagctaccgaagaaaggtgt
tccaaacgtaaatgtttgttccatccaacggactccgacgcgcctgattgctactttcca
ccagattatggctatactgctggagatgaaatgcaaacagcaacaggctggacagtcaac
ttaacgtggaagggaaaggcgccatttcctaatcctatcagtaaagttacttttgctgtg
gaaatgttagataacgccatattgagatttaagctatatgatccatcaaactcccgttac
gaagttccaatgaaaatgaatatccctactcccgttagacgccctgcagatcctcgctac
gacatcatcatgaccagtaaaaatccttttcatttccaagtgaaaagaaaaagcacagga
acaattttgtgggacacgagcgtagggggtctgacgtttgaggaccagtttcttcagatc
gcatctcggcttccctctaggaacgtgtatggattcggagagaatgtgcacacgaccctt
aagcacgacttggactggactatgtggccgatgtttgctagggaccaacctccaggatcg
ggcaaaaatccccgggatgcaaagaatctgtatggtgttcaccctttctacacctgtatg
gaggaggacggacattcgcacggagtcctgcttctcaacagtaactcacaagactacgcc
tttacccccttaccgatgctgatctacaggacaattggtggaatattggacttctatatg
tttctaggacctgagcccgaaaacgtcattcaacaatacacaggggcaatcggtagaccg
atgatgccaccgtattgggcccttggttttcaattgtgtcgctatggttacaacaatata
tcaaatctacaagcggctgtagaaaggaccgtgtctgcgaagattccatttgatgtacaa
tatggcgatatagatcatatggaagaaagaaaggacttcacgattgaccgaggaaacttc
agtggattgaaggagtatttcaacgaacttcgcgataacggcatgcggacgattatcatc
ctggatccttgtctcttggctgataagacatatgcaccataccagaaaatgagcgaacaa
gacggactcatcaaatggcccatgtcttataccgtaccaaatggcagctcagacgaaaat
ggagcacttcttggctatgtgtggcccagtggaaaggtggttttccctgacttctttaaa
aacagcacccgggacgtatggataggtcttattacaaatcactcaacggagatttctttc
gatggtttatggatagatatgaacgaaccagcaaactttggtaccaacgaggagcgtcct
tggaattggccagccaatactactgcttggagtttaaaatgtaaagtcggtgacacatat
gaggatcccccatatagatccatggcggcttttcaatctgacgacggtaacagacttcat
cgaatatcggagaagacgatttgtatggttgctaggcaaggcaaagataacagctacctt
cattacgatgtacatagtttgtacggctggagtcaatctaagccaacactagacggtctc
cagatggcacaaagcggcaagcggggtcttgttatttctaggtcgacctttccaggcagt
ggacagtatgcgggacactggctaggcgataactcggcagattgggatcatttgagatta
tccataatcggtatcctagagtttaatttgtttggcataccatatattggtgcagacata
tgtggcttctttggggaaccttctgctgagctttgcaagagatggatgcaactaggtgct
ttctatactttcagccgaaaccacaatactttaggacagccagatcaagatcctgctgta
tttagcgaaagcgtcactaaagcctctcgcgaagcaatggagacaagatattggcttctt
ccgtacctttatacgctttttcaccatacgcatatacggggaaacacagttatccgaccc
ctccatcacgagtttccaacagacagtgcaacctacggtatagacaggcagtttctatgg
ggacctgccctgttaatatcgcctattttagaggaaggactgacggaagtcagagtctat
ttaccacatgggacgtggtacgacttctacacgggagcaacatttgaaggaaaacaacac
attactgttgaggttaatcaagactcgaagattccactgcatactcgaggagggtatgtg
attccaatgcaggctcctgccaatactacagtatacagtagaaaaaacgcgttctcaatt
acagttgcattagcctctgatggtaaacgaacctcggctgaaggagacatctattttgac
gacggcgaatcaattgattcatacgaaagcggaaactatggtaccgccaaattcattgct
tcggagaggggattgaaaatgcgggtcggacacacttactcatcgacagaggaggctttc
attattggagaaatctgtgtacttggtatcagagaaaacatcactatggtgtatatcaac
agcagcttacaacatctagatattcatcactacaagacaaacaatactctcgtcatttca
aacctatctctcagcttgactgaggagttttatatcgaatggcttactgaacgtaaacta
gaaagagatgaattggaaagaatcaactgttacccagacatggatgacacattttctact
aaaaataaggaagagtgtcgcctccgaggctgcatctggcaagatgcctcccacaagaac
attccaccctgtcacatcaacaagacccaacatggatacttccaaagcaaactggaagtt
ttaagtaactattttgatggcatagtactggaatggaaaaaccagacgcagtttttcgga
ggcaatataccttatgtagaacttcaggtgcataacatatctgaaaacattctgagattg
aagtacatggatttagcatatcgtaggtatgaagttcccgttcagctaaatactacaata
tcaagacaaaaacaagacaacgattaccgggtggagttcagtgagaacagtcacggatca
tttttcgtaagagtgatacgacagagcactaacacgacgatttgggatacatctctagga
ggatttactttcgccgaacagtttttgcagatggttgttaagttaccatcaaaaaacatg
tatgggtttggtgaaaacagacatttttcgttccaacatgacttcgaatttaaacgttgg
cctatgttttcccgtgacaatggcgtgaattggggagactttgcaaatctctacggcgta
catccattttacttaaatattgaagatttcagtggaaattctcatggtgtattgcttcta
aacagtaatgcaatggaaatagagctaaaccctttgccgtctttaacctacagaacaata
ggaggtattctagacttttatatatttctaggaccgacacccgagcaggttattcagcag
tacactagtgtcattgggcatccgtatttaccaccctactggtctcttgggtttcaactt
tgtcgatatgggtacaatagtctccaggccatgaaagaggccgtcgacagaacgaaatca
gccgatattccacaagatgttcaatatgctgacatagaccacatggacgagaggagagac
ttcacagtagacgatgttaattttggtggccttcaaaaatatttcaaggagttacaaaac
gaaggcatgcataccattatcatacttgatccagcactgatcacaaatgtaacagattat
ctcccttacaacgaaggagtcaagaaagacatattcattaagtggcccaatgtagattcg
agtccagattaccaggaattcaatcggacggacatgcttggatatgtgtggcctcaaggt
aaagttgtgttcccggacttcctgaaccctgctacaagggattattggcgagatttaatt
gtgaaccaccataaaaacctatccttcgacggtttgtggatagacatgaacgaaccggca
aactttggcacaaacgaggagcatccatggaattgggacgagaacagtaaaccctactgg
tcattgaattgtccaacttcccgatgggatgatcctccatataaaccgaaagcaatattc
ggatctcggctgtcggataaaacattgtgtatggtggcagtgcagaacgaagcaagacac
atgcactacgacgttcacagtttgtatggctggagtcagacagaacccaccctccacgcc
ctcagggaggccaccagtgagcgcggaattgtcatctcgcgatccacgtatccgtccagt
gggcgttatgctggacattggctcggcgacaatgacagcgcatggtcagatcttcatgac
tctgtaataggcctactggagtttaacctctttggtatcccatacattggagcggatatc
tgtgggtttttcaaaaattctacatcggagctatgtgaacgctggatgcaacttggtgca
ttctataccttctcaaggaatcacaacactattaacactgcaccgcaagacccggcctat
ttcggtccggctgtggcatcctcgtcccgaaaagcgcttatagtgcgttacacgttgttg
ccatacctttacacgttgttttaccacgtccacgtacacgggggtaccgtcatcaagtct
ctaacacacaatttcccgaatgatcaaaccacttggtccgtcgacacacagtttatgtgg
ggaaaggcattcatgatcgctccagttttgcaacaaggcaagacgcaagtcgacgtttat
tttcccgttggtcgttggttcgactactatacaggtcaggaggtgaagagttcctcttcg
ttcgaggttgtatcagcacctcgtgacgtcattccattgtttgtgtatggaggacatata
ctgcctacacagcttgctgcaaacactacagtgtatagtaggcgtaatccaatgggtttg
tttgtagtgttaaatgaaaatgaaacggcaaaaggagatctattttgggatgacggtaaa
tctattgacactgttgaaaatcacgaatacttcctcttgtctttttcgttcaaatcaaat
aatctttccatgacagttgatcaaaaaccattaaataccgatgactttgccaataatctg
atcatcaagaatgtaacaatttacggcaaaaccgtttggaattccgtaaaagtgaacaat
gcatcgcatgatgattttattagtgatacccgtctaaatgtattccgtgtcacaaacctg
aatctagcaattaagaatgactttttaatttcatttctgtga

DBGET integrated database retrieval system