KEGG   Mizuhopecten yessoensis (Yesso scallop): 110466933Help
Entry
110466933         CDS       T05079                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00052  Galactose metabolism
myi00500  Starch and sucrose metabolism
myi01100  Metabolic pathways
myi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:myi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110466933
   00500 Starch and sucrose metabolism
    110466933
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110466933
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:myi04147]
    110466933
Enzymes [BR:myi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110466933
Exosome [BR:myi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110466933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 110466933
NCBI-ProteinID: XP_021379413
LinkDB All DBs
Position
Unknown
AA seq 970 aa AA seqDB search
MKPRFDWLAFTVIFCLLSALLYFNTSVVPQIQIVLLSSLQNDQQQLQGNPLQGNTYNIDK
AGPYVITAHLLNKGSSENLVETNLTENLSDQKQSLKNRQKVKDSCSNFKDSEKFDCDPEG
SVSEAKCQARGCCWHPQVKPPSHPVRGLPLGVPWCFYPDGYPGYIVDSVDYRPTGVRVQI
SRKTNSYYSDDIKTAVMDVTYRSDQTLRIKIFDPSKNRYEVPIYGSPSTQTTNDTLYSFS
VSEVGQPFNFQLVRKTATGLVPVIVLRTNRTAPFMFSDQYIQLASFLPSNYIYGLGEHRG
SLLHDVNWKQFTMWNKDRPPKENTNLYGSHPFYLVMEGRDGGSHGVFLANSNAMDVILQP
APAITWRTIGGIIDMYVFLGPSPAAVIQQYTEVIGRSFMPPYWSLGYHLCRWGYKTANGT
LAITDRVQAAGIPQDVQWNDIDYMDRKLDFTTGPKFGDQSTMVDNLHKRGMHYIMILDPG
ISTSQKPGSYMPYDVGIKMDIFIKDSSGKPIVGKVWPGNTVFPDFTHPLAAQYWTSLIRE
FHDNVPFDGIWIDMNEISNFVAGSLSGCPSNSSLENPPYLPAVEGGSLRFNTLCASARQN
LSVCYNTHNLYGLTETMATYKALQLVRGKRPFIISRSTFPGQGQFGGHWSGDNDATYSDM
YFSIPEILNFNMFGISMIGADICGFRSETNEQLCVRWHQLGAFYPFSRNHNTLGMKDQDP
AAFSHNAVMAIKSVYLVRYSLLPYLYTLFHKSHQMGHTVARPLFFEFPEDEKTYSIDRQF
LWGEALMISPVLTKDATTVDIYFPGFRWYDFYNGRHNYTTGSVQNLPAPINQINLHVREG
YILPMQEPALTTTDSRKNPFSLLVALNEKGEAQGSLFWDDGDTIGTYTSEKYITMQFQAG
KQVLQSQILHNGYLTSATWGSITVYGVTQNPTSVTVNGQTVKNTYDHNYKVLHVSDLTLD
LVLAFKMAWK
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atgaagccacgttttgactggctggcttttacagtcatcttttgcttactgagtgcactg
ctgtacttcaatacttcagtggtgccccagatacagattgttttactgagctctctgcaa
aatgatcagcaacaactccaaggaaatcccctccaaggtaacacctacaacattgataaa
gcaggcccatatgttatcacagctcatttgttaaacaaaggcagttctgaaaatcttgtg
gaaaccaacttgacagagaacttatctgatcaaaagcaaagtttgaagaatagacagaaa
gtgaaggacagttgcagtaattttaaagatagtgagaaatttgactgtgatccagaagga
tcagtatctgaagccaaatgtcaggcgagggggtgttgttggcacccccaagtaaaacca
ccatctcatcctgttagaggtctgccactaggtgttccctggtgcttttaccctgatggc
tacccgggttatattgtggacagtgttgactaccgccccactggggtcagggttcagatc
tccaggaaaactaactcctactactccgacgacatcaagacagctgtaatggatgtcact
tatagatcggatcaaacactgaggatcaagatatttgaccccagtaagaacaggtacgag
gttccgatatatggctccccatcaactcagacaaccaatgacactctgtacagcttctcc
gtcagtgaggtggggcaaccattcaacttccagctggtcaggaaaactgccacgggtcta
gtaccggtcatcgtattaaggaccaatcgtacagcaccattcatgttcagtgaccagtac
atccagctagcctctttcttaccctccaactatatctacggtctgggagaacacagaggg
agtctacttcatgatgtaaactggaaacagttcaccatgtggaacaaggaccgtccacca
aaagaaaatactaacctgtatggttcccatccattttaccttgtaatggagggcagagat
ggggggagccatggagtcttccttgccaacagcaatgctatggatgtaattctgcagcca
gcaccagctataacctggcgtaccattggtgggattattgacatgtatgtgttccttggg
ccgtctccagctgctgttattcagcagtacacagaggtcatagggcgatcgttcatgccg
ccctactggagccttggataccacctgtgtaggtggggttataagacagctaatggcacc
ctcgctatcacagacagggttcaagcagcggggattccacaggatgtccagtggaacgac
attgactacatggacaggaagctagacttcaccactggaccaaagtttggtgaccaaagc
accatggtggacaatcttcacaagcggggaatgcactacatcatgatactagatccagga
ataagtacctcacaaaagcctggctcctacatgccttatgatgttggaatcaaaatggac
atcttcatcaaagacagctcgggaaaacctattgttggcaaggtgtggccaggtaacact
gtattcccagacttcactcatcctttagcagcccagtactggacctcactgatcagggaa
ttccacgacaacgttccatttgacgggatatggattgatatgaatgaaatatccaatttt
gttgctggctcattatctggatgtccctccaactcatctctggagaatcctccctatctg
ccagctgtggaaggaggatctctacgattcaacacattgtgtgcctcggcaaggcagaac
ttgtcagtgtgttacaacactcacaatctgtatggcctcacagagaccatggcaacatac
aaagctctacaacttgtacgcgggaagagacctttcataatatccaggtcaaccttcccc
ggtcaaggtcaatttggaggtcattggtcaggagacaatgatgctacatacagtgacatg
tacttctctataccagaaatactcaacttcaacatgtttggaatttccatgattggggct
gatatctgtggtttccggtcagagacaaatgaacaattgtgtgtccgttggcatcaactt
ggagctttctatccattttctcgtaaccacaacactttaggaatgaaggaccaggatccg
gctgccttcagccataatgctgtgatggctattaagtcagtgtacctggtacgctactcc
ttacttccctacctctacactcttttccacaaaagtcaccagatgggacacaccgttgcc
agaccactgttctttgagtttccagaagatgagaagacttatagtattgatcgccagttc
ttgtggggtgaggcactaatgatttcaccagtccttacaaaggatgccacaactgtcgac
atatatttcccggggtttagatggtacgacttctacaacggtcgccataactatactact
ggtagtgtacagaacctgcctgctcccatcaaccagatcaacctacacgtgagggaaggg
tacatccttcccatgcaggaacctgccttgactacaacagacagccgaaagaaccccttt
agtctgctggtggctctgaacgagaagggagaggcacagggaagcttgttctgggacgat
ggagacacaataggaacctatacatctgaaaagtatatcacgatgcagtttcaagctgga
aagcaagttttacagagccagatattgcataatggttacttgacgtctgcgacctggggt
agcataacagtctatggtgtgacacagaacccaacatcagtcacagtcaatggacagact
gtaaaaaacacttacgaccacaactacaaggttctccatgtcagcgaccttactctggac
ctggtgctggcctttaagatggcctggaaatag

DBGET integrated database retrieval system