KEGG   Mizuhopecten yessoensis (Yesso scallop): 110467271Help
Entry
110467271         CDS       T05079                                 

Definition
(RefSeq) taurocyamine kinase-like
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
myi  Mizuhopecten yessoensis (Yesso scallop)
Pathway
myi00330  Arginine and proline metabolism
myi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    110467271
Enzymes [BR:myi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     110467271
Exosome [BR:myi04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   110467271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 110467271
NCBI-ProteinID: XP_021380003
LinkDB All DBs
Position
Unknown
AA seq 739 aa AA seqDB search
MCGQAGSKIANMNEVVGDVDELYAMLQKGNTKSLLKKHLTQERFDLLKDKKTSIGGTLAQ
CINSGCKNMHSGVGLYACDPEAYEVFKELFDPLIMDYHKITKVEHPTPDFGDMDKLGFDD
LDPAGEFIVSTRVRVGRSHAGFPFPPGADEQKRRDMEDKTIKALEHLDGDLKGEYFSLEK
MTKEDEKQLIEDHFLFKDDDKCLRSACGYNDWPIGRGIYFSKDKKFLTWINEEDHLRFIS
MQKGGDLATVWKRLVTAVKTLEKNLNFAKSNRHGYLTFCPTNLGTTCRASVHIKVPKLAK
AARETEGSGSRLDEVCEKFNLQPRGIHGEHTESVGGVYDISNKRRMGLTEFDAITEMKNG
IVEIMKIEKELDYIPASLEELWKKLKNGESNSLLKKHLTEPIYNKLKDKVTYLKGTLADC
IRSGCNNLDSGCGIYACDAEAYDVFSDVLFPVIKDYHKVDEVKHPNPDFGDIKNLGFGDL
DPSKKYIISTRVRVGRSLAGYPFPPTATLKDRMEMEARDKDAFETLKGELKGTYYPLYGM
NRATQLQLTEDHFLFNDSDRFLREASGFDDWPVGRGIFHNPQKTFLVWVNEEDHLRFISM
QMGGDLAAVYTRLVTAVQAMEKSGLKFAHHHKLGYLTFCPTNLGTTLRASVHIRIPKLST
NPEFKAFCDRFNLQARGIHGEHTESVGGVYDISNKRRLGLTEIEAVQEMRKGVEAVIAEE
RKLDGSSGPQSTSRFGRKA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtcaagctgggagtaagatcgccaacatgaatgaggtggtaggggacgtggac
gaactgtacgccatgttacaaaaaggaaacactaaatccctacttaagaagcatcttaca
caggaaagatttgatctgctgaaggacaagaagacgtcgataggaggcacactagcacaa
tgtataaattcaggctgtaagaacatgcacagtggtgtgggtctgtacgcgtgtgatcca
gaagcctatgaagtctttaaagaactgtttgatccgctaataatggactatcacaagatc
acaaaggtagagcatcccaccccagacttcggagacatggacaaactcgggtttgatgat
ctggatcccgccggcgaatttatcgtctccacacgtgtacgtgttggtagaagtcacgcg
ggcttccccttccctccaggtgcagacgagcagaaacgtcgagatatggaggataagacg
atcaaggctctggaacatttggatggcgatctaaagggggagtacttctcactggaaaag
atgacaaaggaggatgagaaacagctcatagaggaccacttcctcttcaaggatgacgac
aaatgtctgcgatcagcatgtggctacaacgactggccgataggccgtggtatctacttc
agtaaagacaagaagttcctcacctggattaacgaggaggaccatctccgcttcatctcc
atgcaaaaaggaggggacttggctaccgtctggaaaaggcttgtaacggccgttaagacg
ttggagaagaacctgaatttcgcaaagagcaacagacacggctaccttacgttctgtcct
acaaatctcggtactacatgcagggctagtgtccacatcaaggtacctaaactggctaaa
gccgcgcgtgaaaccgaggggtcaggcagccgtctggatgaggtgtgcgaaaagttcaac
cttcagccaagaggtatccacggggaacacacggagagtgtgggaggggtgtacgacatc
tccaacaagaggcgtatgggactgacagagtttgacgccatcacagaaatgaagaacggt
attgtggaaatcatgaagatagagaaagagctagattatattccggcgtcgttagaagaa
ctctggaagaaactgaaaaatggcgagtcaaactctttactgaagaaacacctgaccgag
ccaatctacaacaagctaaaagataaggttacttacctgaaaggaacattagcagattgc
attaggtcaggctgcaacaatctcgacagtggctgtggtatttatgcttgtgatgctgaa
gcatacgacgtcttctccgacgtactcttcccagtcatcaaagactaccacaaagtggac
gaggtcaaacatcctaaccccgactttggagacatcaagaacttagggtttggcgatctt
gacccctctaagaagtatattatctcaacacgtgttcgtgtgggacgttcgttggccggt
tacccattcccccccacagctacattgaaggaccgtatggaaatggaagctagagacaag
gacgctttcgagaccctaaagggagaactgaaaggcacctactaccccctgtacggcatg
aacagagccacacagctgcagcttacagaggatcacttcctcttcaacgacagcgacagg
ttcctgagggaagccagtgggtttgacgactggccggttggcaggggaatcttccacaac
cctcagaagacattccttgtgtgggtgaatgaggaggaccatctacgatttatctctatg
cagatgggcggagaccttgcagccgtgtacacacgtctggtcacggctgtccaagccatg
gagaagagcggtttgaagttcgcccatcatcacaaactgggttacctgaccttctgtccg
acaaaccttggcaccaccctcagggccagtgttcacatcagaatccccaagctatctacc
aaccccgagttcaaggccttctgtgatcgcttcaacctacaagcccgaggtatccacgga
gaacacacggagagtgtgggaggggtgtacgacatctctaacaagaggaggctgggtttg
accgagatcgaggctgtacaggaaatgaggaagggtgttgaggccgtgattgctgaggag
cggaagttggacggctcaagcgggccacaatcgaccagcagatttggacgcaaagcataa

DBGET integrated database retrieval system