KEGG   Mycetocola sp. 449: C3E77_01795Help
Entry
C3E77_01795       CDS       T05409                                 

Definition
(GenBank) PucR family transcriptional regulator
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
myl  Mycetocola sp. 449
Brite
KEGG Orthology (KO) [BR:myl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:myl03000]
    C3E77_01795
Transcription factors [BR:myl03000]
 Prokaryotic Type
  Other transcription factors
   Others
    C3E77_01795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30
Motif
Other DBs
NCBI-ProteinID: AWB85486
LinkDB All DBs
Position
complement(366369..367886)
Genome map
AA seq 505 aa AA seqDB search
MQPTVHGLLNNAGLGLRLLAGDNSSKLSEPVSWIHSSDLADPTPFLDAGHLVLTTGTQFE
AATAATFSGYVERLADHGILGIGFGSEVVRAETPDGLIAACDGAGMPLFEVPYRVPFIAV
VRSVADLIAEAAHARDTWALNAQRAISFAALKPDAVASVLAELSRQLGRWVALYDYRGQK
TVTVDEASVLVHLDVPELMTRVDAEAGRLIARGQRSSSTISDTTGQVSLQTLGRRGELRG
VLVIAGVEPLDAADQSVVTSVVALVGLAIEQARELGRTHGRLRGGLFQALLEGNVAFVQR
IVSQLGGMLPAEPVRVVAVEVPQDSRDVLVSELDVRPGGEPFLAAEDGRVYVCVAAEDAV
TLADELSLAHSLAVGISDPLPLAATATGVEQAVRALDKAGVASVLEFGALVSGSLAGLLR
DTSATELARALLRPVREHDAATGMTLVESARVWLEHNGSWDPAAKQLGIHRHTLKSRVGL
VEKLTGRELQSFEARTNLWLALQLE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccaccgtgcacggcctgctcaacaatgcgggcctcgggctccggctcctcgca
ggggacaactcgtcgaagctctcggaacccgtctcctggatccacagctccgacctcgcc
gacccgacgccattcctcgacgccgggcacctggtgctcacgacgggcacacagttcgag
gcggcgacagcggccaccttctccggctatgtcgaacggcttgccgaccacggcatcctc
ggcatcgggttcggaagcgaggttgttcgcgccgagacgcccgacggcctcatcgcggcg
tgtgacggagccggcatgcccctgttcgaggtgccgtaccgggtgccgttcatcgcggtg
gtcaggtcggttgccgacctcatcgccgaggccgcgcatgcgcgcgacacctgggcgctc
aatgcacagcgtgctatttcctttgcagcattgaaaccggatgccgttgcctcggttctc
gccgaactctcccgccagctgggtcgatgggtggctctctatgactaccgcgggcagaaa
accgtgacggtcgacgaggcatccgttctggtgcacctcgatgttccagagctgatgacg
cgcgtggacgcggaagccggacggctgattgcacgcgggcaacggtccagttcgacgatc
agcgacaccacgggccaggtatcgctgcagaccctcggccgccgcggggagcttcgcggt
gtgctcgtcatcgcgggtgtcgagccgcttgacgcggcagatcagagtgttgtgacgagc
gtcgttgccctggtcgggctggccatcgagcaagctcgggagctcggccgcacgcacggc
cggttgcgcggcgggctttttcaggccttgctcgagggcaatgtggccttcgttcagcgg
atcgtttcgcagctgggcggcatgctcccggccgaacccgtgcgcgtggtcgcggtggag
gtaccgcaggactcccgcgatgtgctcgtgtccgagctcgacgtccgcccgggtggcgag
ccgttcctcgcggcggaagacggccgagtgtacgtgtgcgtggccgcggaggatgccgtc
acgctcgcggacgagctgagcctcgcgcactccctcgcggtggggatttccgacccgctc
ccgttggcggcgaccgcgacaggggtggagcaggccgtgcgcgccctcgacaaagcgggc
gtggcatccgttctggagttcggtgccctcgtttcagggagcctcgccgggctgcttcgc
gacacgtcggcgaccgagctcgccagggcgctgcttcgaccggtcagggaacacgatgcg
gccaccggcatgactctcgtcgagagcgcacgcgtgtggcttgagcacaacgggtcgtgg
gacccggcggccaaacagctcgggatccacaggcacacgctgaagagcagggtcggcctc
gtggagaagctcaccgggcgggagcttcagagcttcgaggcccgcaccaacctgtggctg
gcactgcaactcgagtag

DBGET integrated database retrieval system