KEGG   Mycetocola sp. CGMCC 1.16372: C3E77_02730Help
Entry
C3E77_02730       CDS       T05409                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
myl  Mycetocola sp. CGMCC 1.16372
Pathway
myl00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:myl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C3E77_02730
Enzymes [BR:myl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C3E77_02730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 Glyco_hydro_2_C Cellulase DUF4434 DUF4350
Motif
Other DBs
NCBI-ProteinID: AWB85646
LinkDB All DBs
Position
complement(574909..576897)
Genome map
AA seq 662 aa AA seqDB search
MSWIPGSKGLRYGGDYNPEQWDRETWVEDIALMKEAGVNLVSIGIFSWVVLEPREGEYDF
SFLDDIIGLLADAGIDVDLGTPTAAPPAWFWKKYPAAHPMTRDGRTLGFGSRGMVSPSSP
EYRRASVAIATKLAERYAQHPAVVMWHVHNEYGAPISDSYDDYSVAAFREWLQARYGTLD
ALNRAWGTRFWGQSYGEWDEIDAPRVSASTSNQAQRLDFQRFTSDALLACFIGERDAIRA
FTDAPITTNFMATNCPSIDYWKWAQEVDIVANDHYLVAERTDNHVLLAMDADFTRSLAGS
RPWILMEHSTSAVNWQPRNIAKRAGEMARNSLSHVARGSDAVMFFQFRASRFGAEKFHSA
MLPHGGTSTRIWNEVVQLGSDLRALEPVAGSRVTASVAIVWSIESFWALDLEWRPSVELG
HRERIEAFYSALWGLGVTVDFVHPSADLSGYDVVFAPSLYLLAEADAANIDSYVSSGGTL
VVSYFSGIVGENDEVPAGASPGALRDVLGLSIEEFLPLYADQAVALSDGSTGSAWADDIV
LDTAVAVDTYVDGPAAGKPAVTRNTRGSGTAWYVSTKLVGDDLLRFVTSVLDASGVAVDA
PPAGLEVVTRSTDSESFTFFINHADAPAPVSIEGTDVLTGEPVSAGSVVPAGGVRVVASA
RP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggattcccggctcaaaaggccttcgctacggtggcgactacaaccccgaacag
tgggaccgcgagacctgggtcgaagacatcgcgctcatgaaagaggcgggcgtcaacctc
gtcagcatcggcattttctcctgggtggttctcgagccgcgtgagggcgagtacgacttc
agcttcctcgacgacatcatcggcctgctcgcggatgccggtatcgacgtcgacctcgga
accccgaccgccgcgcccccggcctggttctggaagaagtacccggccgcccacccgatg
acccgcgacggacgtactctcggcttcggctcgcgaggaatggtgagcccgagctcccct
gagtaccggcgtgcgagcgttgcgatcgcgacgaaactcgcggaacgctacgcgcagcat
cctgccgtcgtgatgtggcacgtgcacaacgagtacggtgcgccgatcagcgacagctac
gacgactactcggtcgccgcattccgggagtggctgcaggcccgctacggcacgctcgac
gcgctcaaccgcgcctggggcacccggttctggggccagtcctacggcgagtgggacgag
atcgacgcaccgcgggtctcagcgagcacgtcgaaccaggcccagcgactcgacttccag
cggttcacctccgatgccctgctcgcttgcttcatcggcgagcgcgacgcgatccgtgcg
ttcaccgacgcgcccatcacgacgaacttcatggcgaccaactgcccatccatcgactac
tggaaatgggcgcaggaggtcgacatcgtcgcaaatgaccactacctcgttgccgagcgc
accgacaaccacgtgctgctggcgatggacgccgacttcacgcgttcgctcgccggctcc
aggccctggatcctgatggagcactccacctcggcggtcaactggcagccacgcaacatc
gccaagcgcgccggcgagatggcccgcaacagtctctcccacgtggcgcgaggttcggat
gccgtgatgttcttccagttccgggcgagccggttcggtgccgagaagttccactcggcg
atgctgccccacggtggcaccagcacacgcatctggaacgaggtcgtgcagctgggctct
gaccttcgggcactcgagcctgtcgcgggatcgcgggtgacggcatccgttgccatcgtc
tggagcatcgagtcgttctgggccctcgacctggagtggcggccctcggtcgaactcggc
caccgcgagcgcatcgaggcgttctacagtgcgttgtggggcctcggcgtcaccgtcgac
ttcgtgcacccgagcgccgacctgtcggggtacgacgtggtcttcgcgccgagcctctac
ctgctcgccgaggcagacgctgcgaacatcgacagctacgtatcgagcggcggcaccctc
gtcgtctcgtacttctccggcatcgtcggcgagaacgacgaggtccctgcgggtgcgtcg
ccgggagcgctgcgcgacgtgctcggcctgtcgatcgaggaattcctgccgctctacgcc
gaccaggccgttgcgctcagcgacggctcgacgggcagcgcgtgggctgacgacatcgtg
ctcgacacggccgtggccgtcgacacctacgtcgacgggcccgctgccggcaaacccgcg
gtgacgcgcaacacccgcggatccggcaccgcctggtacgtctcgacgaagctcgtgggc
gacgacctcctccggttcgtgacttcggtgcttgacgcgagcggcgtcgcggtcgacgcg
ccccccgcgggcctcgaggtcgtgacgcggtcgacggactccgagagcttcaccttcttc
atcaaccacgcggatgcccctgcaccggtttcgatcgagggcaccgacgtcctcacgggt
gaaccggtgtcggcgggctcggtggttccggccggcggggtgcgcgtggtggcgagcgcg
cggccgtag

DBGET integrated database retrieval system