KEGG   Mycetocola sp. CGMCC 1.16372: C3E77_04600Help
Entry
C3E77_04600       CDS       T05409                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
myl  Mycetocola sp. CGMCC 1.16372
Pathway
myl00010  Glycolysis / Gluconeogenesis
myl00030  Pentose phosphate pathway
myl00051  Fructose and mannose metabolism
myl00052  Galactose metabolism
myl00680  Methane metabolism
myl01100  Metabolic pathways
myl01110  Biosynthesis of secondary metabolites
myl01120  Microbial metabolism in diverse environments
myl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:myl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3E77_04600
   00030 Pentose phosphate pathway
    C3E77_04600
   00051 Fructose and mannose metabolism
    C3E77_04600
   00052 Galactose metabolism
    C3E77_04600
  Energy metabolism
   00680 Methane metabolism
    C3E77_04600
Enzymes [BR:myl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     C3E77_04600
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     C3E77_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AWB85964
LinkDB All DBs
Position
991000..992028
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRGAVLKGTKIHNQEFIGIRDGWKGVVEGLTMPLDRHSVRGL
GKQGGTILGTSRTNPFEGPHGGPENVQATLDRLGIDALIAIGGEGTLAAAKRLTDAGLQI
VGVPKTIDNDLDATDYSFGFDTAVEIATEAIDRLRTTGESHKRCMVVEVMGRHVGWIALH
SGMAAGAHAILIPEQPQSIDQICEWAKSVGDRGRAPVIVVSEGFTLDTMESAHSEKGLDA
FNRPRLGGIADVLAPIIEERTGIESRATVLGHLQRGGVPSAYDRVLATRLGMAAIDSVMN
KEWGTMVALRGTDIVNVPFEDALGGLKTVPQERYDEAAILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtgtactcaccagcggcggcgactgccccggactgaacgccgtcatccgt
ggagccgtgctcaagggcaccaagatccacaaccaggagttcatcggaattcgtgatggg
tggaagggcgtcgtcgagggactgaccatgccgctcgaccgccacagcgtgcgcggcctt
ggcaagcagggtggcaccatcctcggcaccagtcgcacgaatccgttcgagggcccgcac
ggcggccccgagaacgtccaggcaactctcgacaggctcgggatcgacgcactcatcgcg
atcggcggagagggcactctcgcagcggcgaagcggttgacggatgccggactccagatc
gtcggagtgccgaagaccatcgacaacgacctcgacgccaccgattactcgtttggcttc
gataccgccgtcgaaatcgccaccgaggcgatcgaccgactgcgcaccactggtgagtcg
cacaagcgctgcatggtcgtcgaagtgatgggtcgccacgtcggctggatcgcactgcac
tccggcatggcagcaggcgcccacgcgatcctcatcccggagcagccacagtcgatcgat
cagatctgcgagtgggcgaagagcgtcggagaccgcggccgcgccccggtcatcgtggtc
tcagagggattcacactcgacaccatggagagtgctcactccgagaaggggctcgacgcg
ttcaaccgtccccgcctcggcggtatcgctgacgtgctcgcacccatcatcgaggagcgc
accggcatcgagtcccgcgccacggtgctcgggcacctccagcgcggcggtgttccgagt
gcatacgatcgcgttctcgccacccgcctcggcatggcggcgatcgactccgtcatgaac
aaggagtggggcaccatggtcgcgctgcgcggcaccgacatcgtcaacgttccgttcgag
gatgccctcggcgggctgaagacggtgcctcaggagcgctacgacgaggccgcaatactc
ttcggttaa

DBGET integrated database retrieval system