KEGG   Mycetocola sp. 449: C3E77_06405Help
Entry
C3E77_06405       CDS       T05409                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
myl  Mycetocola sp. 449
Brite
KEGG Orthology (KO) [BR:myl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myl01001]
    C3E77_06405 (pknB)
Enzymes [BR:myl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     C3E77_06405 (pknB)
Protein kinases [BR:myl01001]
 Serine/threonine kinases: Other
  Bacterial family
   C3E77_06405 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: AWB86279
LinkDB All DBs
Position
complement(1354419..1356353)
Genome map
AA seq 644 aa AA seqDB search
MTTSQQTDPIIGRLIDDRYDVRSRIARGGMATVYLATDLRLERRVAIKVMHGHLADDSNF
RNRFVQEARSAARLADPHVVSVFDQGQDSDLAYLVMEYLPGITLRELLRDHGKLTARQVI
DIMDAVTSGLAAAHRAGIIHRDVKPENVLLADDGRIKISDFGLARAASANTATGQSLLGT
IAYLSPELVTRGIADARSDIYALGIMMYEMLTGEQPYKGEQPMQIAYQHANESVPRPSAV
NPDVPDALDDLVLWATERSPDERPSDAREMLERLREVEKQLGFGGAASTQATMVMASPPA
SDTAGFTQVLTSPSMRADPVDPDDPASALSAVTAKRRTRGYWILGLVLILAALSGGTGWY
FAAGPGSHVSVPSLVNESPESASQILTDLGLTVTPGEEYSFDVPVGLVSSTDPGDGALVD
KGSSVTVNVSLGRAPVTVPALAGMPLADAEAYLNDNRLTLGSVDQQFNDDAADGIVLSAA
DAASGADVSGGGEILQGETINLAVSLGGIPSVGGMSPDEARSALTGRGLVVADKSKEEFS
DEVAKGVVIRAELPDGTIRPTDTATLVVSKGEDLVTVPDVVGKVLAEAKAELEDLGFTVK
VISDVAETNWGFPLVTVDQSDPAGGTAIKRGATVTLTSYLFEAP
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaccagccagcagaccgacccgattatcggccgtctcatcgacgaccgatatgac
gtgcgttcgcgcatcgcgcggggcggcatggcgacggtctacctcgccaccgatctgcgt
cttgaacgccgcgtggccatcaaggtcatgcacgggcacctggctgacgacagcaacttc
cgcaatcggttcgtgcaggaagcgcggagcgcggcgaggcttgccgatccgcacgtggtg
agcgtgttcgaccagggccaggattccgacctcgcgtacctggtcatggaatacctgccg
gggatcaccctcagggaactgcttcgcgaccacggcaagctcacggcacgccaggtcatc
gacatcatggatgccgtgacgagcggcctcgcagcagcgcaccgcgccggaatcatccac
agggacgtgaaaccggagaacgtcctcctcgccgacgacggccggatcaagatcagcgac
ttcggactggcccgtgccgcgagtgcgaacaccgcgacaggacagtccctgctcggaacc
atcgcctacctctcccccgagctcgtcacccgaggcatcgctgacgccagaagcgatatc
tacgccctcggcatcatgatgtacgaaatgctcaccggcgagcagccgtacaagggcgaa
cagcccatgcagatcgcgtaccagcacgccaatgagtcggtcccacggcccagtgcggtc
aacccggatgtgccggacgccctcgacgacctcgtcctctgggcaacggaacgatcaccg
gacgagcgtccgagcgacgccagggaaatgctcgagcggctgcgcgaagtagagaagcag
cttggtttcggcggtgcagcgagcacccaggcgacgatggtcatggctagcccgcccgca
agcgataccgcgggtttcacgcaggttctgacatccccctcgatgcgtgcggacccagtg
gatcccgatgaccctgcgtctgcgctcagcgcggtgacggcgaagagacggaccaggggg
tactggatcctcggccttgtcctgatccttgccgcactctccggaggcaccggctggtat
ttcgctgccggtcccggttcgcacgtctcggtaccgtcgctcgtcaacgaaagcccagaa
tccgccagccagatcctcaccgatctcggcctcaccgtaacgcccggcgaggaatacagc
ttcgacgtccctgtcggtctcgtatcgagcacagacccaggagacggcgccctggtcgac
aagggctcgagcgtcacggtcaatgtgtcgctcgggcgcgcgcctgtcaccgtacctgcc
ctcgccgggatgcccctggccgacgccgaggcatatctcaacgacaaccgcctcaccctg
ggcagcgtcgaccagcagttcaatgacgacgcggccgacggcattgtcctctccgctgcg
gatgccgcatcgggcgcggatgtttcgggcggcggcgagatcctccagggcgagacgatc
aacctcgctgtttcgctcggaggtatcccctccgtcggcgggatgagcccggacgaggcg
aggagtgcgctcaccgggcgcggactcgttgtcgccgacaagagcaaggaagaattcagc
gacgaggtcgccaagggcgttgtgatcagggctgagttgcccgatggcaccatccgtcca
accgacaccgctaccctcgtcgtctcgaagggcgaagacctcgttacggttccggatgtc
gtcgggaaggtgctcgccgaagcgaaggccgaactcgaggaccttggattcacggtcaag
gtgatcagcgacgtcgccgagacgaactggggcttcccgctcgtcaccgtcgaccagtcc
gaccccgcgggcggaacggcgatcaagcgtggggcgacggtcacgctgacctcatacctc
ttcgaagcgccctag

DBGET integrated database retrieval system