KEGG   Myxococcus hansupus: A176_000194Help
Entry
A176_000194       CDS       T04077                                 

Definition
(GenBank) Methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
mym  Myxococcus hansupus
Pathway
mym02020  Two-component system
mym02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mym00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A176_000194
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    A176_000194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:mym02035]
    A176_000194
Bacterial motility proteins [BR:mym02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    A176_000194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP Laminin_II DUF948 DUF2203 ATG16 CorA Dor1 T7SS_ESX_EspC Bacillus_HBL Phasin_2 EURL CENP-F_leu_zip
Motif
Other DBs
NCBI-ProteinID: AKQ63282
UniProt: A0A0H4X5Y5
LinkDB All DBs
Position
223261..224565
Genome map
AA seq 434 aa AA seqDB search
MDSPRATREVSLHRKILNGYVVLGLLLTVWMYASDVLFHQLSPGPAVWKDITRVGVAIFI
TGAAAALLPSLLARVTRVKVLSRSAYEISQGDLSKPVAAEGGSTRDEIDELTGAITRMQE
NLRELVGKIQETAKSVADTAIDLQRSAENVNGSTEEVGSSMEKIAGGAESQSQLVSKASK
VITEMAGSIQRTTASAEDAARTTAETSSAAEDGSKAARLAGDKVKKVFNRIESASQQVFA
FGEKTQEISKIVDAITQVAQQTNLLALNATIEAARAGEYGRGFAVVADEVRKLAESAGRS
AEQISKLARDISGQSTSVVSAMKEGIAELAEGREDLTNIVRSMGAITDTIRKGSEKVHLI
SESAREQLKGSEEMVKAIEEIKLVARNNASSTEAIQAVIQEQTAAVSRMTSLASELTNLS
VELQSVVRSFRLGS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggacagccctcgcgcgacccgcgaggtctccctgcaccggaagattctcaacggctac
gtggtgctgggcctgctgctcacggtgtggatgtacgcgtcggacgtcctcttccaccag
ctcagccccgggcccgcggtgtggaaggacatcacccgcgtgggcgtcgccatcttcatc
accggcgcggccgcggcgctgctgccgtcgctgctggcgcgcgtcacccgcgtgaaggtg
ctcagccgctccgcgtatgaaatctcgcagggcgacctgtccaagccggtggccgccgag
ggcggcagcacgcgcgacgaaatcgacgagctgacgggcgccatcacccgcatgcaggag
aacctgcgcgagctggtgggcaagattcaggagacggcgaagagcgtggccgacacggcc
atcgacctccagcgctcggcggagaacgtcaacggctccaccgaggaggtgggctcgtcg
atggagaagatcgctggcggcgccgagtcgcagtcgcagttggtgtccaaggcgtcgaag
gtcatcaccgagatggccggcagcatccagcgcaccacggccagcgccgaggacgcggcg
cggacgacggcggagaccagcagcgcggccgaggacggctccaaggcggcccggctggcc
ggcgacaaggtgaagaaggtcttcaaccgcatcgagtccgccagccagcaggtgttcgcc
ttcggggagaagacgcaggaaatctccaagatcgtcgacgcgattacgcaggtggcgcag
cagacgaacctgctcgcgctcaacgcgacgattgaagcggcgcgcgcgggtgagtacggc
cgcggcttcgcggtggtcgccgacgaggtccgtaagctggccgagagcgcgggccgttcc
gccgagcagatttcgaagctggcgcgcgacatctccggccagtccacctccgtcgtgagc
gccatgaaggaaggcatcgcggagctggccgagggccgcgaggacctgaccaacatcgtg
cgctccatgggcgccatcaccgacaccatccggaagggctcggagaaggtgcacctcatc
tccgagagcgcccgtgagcagctcaagggcagcgaggagatggtgaaggccatcgaggag
atcaagctggtggcgcgcaacaacgcctcctccacggaggccatccaggccgtcatccag
gagcagacggccgccgtgtcgcgcatgacgtcgctggccagcgagctgaccaacctctcc
gtcgagctgcagagcgtcgtgcgcagcttccgcctgggctcatga

DBGET integrated database retrieval system