KEGG   Myxococcus hansupus: A176_000496Help
Entry
A176_000496       CDS       T04077                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabZ form
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mym  Myxococcus hansupus
Pathway
mym00061  Fatty acid biosynthesis
mym00780  Biotin metabolism
mym01100  Metabolic pathways
mym01212  Fatty acid metabolism
Module
mym_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A176_000496
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A176_000496
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mym01004]
    A176_000496
Enzymes [BR:mym01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     A176_000496
Lipid biosynthesis proteins [BR:mym01004]
 Fatty acid synthase
  Component type
   A176_000496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: AKQ63584
UniProt: A0A0H4WLI7
LinkDB All DBs
Position
complement(588192..588677)
Genome map
AA seq 161 aa AA seqDB search
MPSAPSAAPTSLGIQELLGLLPHRYPMLMVDRVDQLEPGVFAEGVKCVTVNEPFFQGHFP
EHPIMPGVLIVEAMAQVAGVMLRTRPRVAEVPERQTSSAPARPGLMANIQRMRFRRPVLP
GDQLRIRATHLKSLGGLHHVKVEARVGDELAADGELMLGGG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgcctagcgcgccgtccgcggcgcccacctcgctggggattcaagaactcctcgggctg
ctgccgcaccgctatcccatgctcatggtcgaccgcgtcgaccaactggaacccggcgtg
ttcgccgaaggcgtcaaatgcgtcacggtgaacgagccgttcttccaggggcacttcccc
gagcaccccatcatgccgggcgtgctcatcgtcgaggcgatggcccaggtggcgggggtc
atgctgcgcacccggccccgcgtggccgaagtgcctgaaagacagacgtcatcggcgccg
gcccgtccggggttgatggccaacatccagcgaatgcgattccgacgtcccgtccttccc
ggagaccagctccgtatccgggccacgcatctcaagagccttggcggcctccatcacgtg
aaagtcgaagcacgtgtgggcgacgaactcgccgcggacggcgagctgatgctcggcggc
ggctaa

DBGET integrated database retrieval system