KEGG   Myxococcus hansupus: A176_000763Help
Entry
A176_000763       CDS       T04077                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mym  Myxococcus hansupus
Pathway
mym00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A176_000763
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mym02000]
    A176_000763
Enzymes [BR:mym01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A176_000763
Transporters [BR:mym02000]
 Other Transporters
  Pores ion channels [TC:1]
   A176_000763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_2
Motif
Other DBs
NCBI-ProteinID: AKQ63851
UniProt: A0A0H4WKG0
LinkDB All DBs
Position
complement(889371..889979)
Genome map
AA seq 202 aa AA seqDB search
MKLFHAPGACSLSPHIVLREGGLPFTLEKVDIRAKKTETGADFLAINAKGYVPAIQFDDG
SVLTEVPAILQFLADQVPDKKLAPANGTLERYRLQETLSFISSELHKGFSPLFNPALPEA
AGQLTRERLALRLGHAESVVAKQAFIAGDQFTIADAYLFTVLNWAGHTKVDLTPFPALRA
YHARVAERPAVQEALKAEGLVK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttccatgctcccggcgcctgttcgctgtccccgcacatcgtcctgcgtgaa
gggggcctccccttcacgctcgagaaggtggacatccgcgccaagaagacggagacgggc
gcggacttcctcgccatcaacgccaagggttatgtcccggcgatccagttcgacgacggc
agcgtgctgacggaggtccccgccatcctccagttcctggcggaccaggtccccgacaag
aagctggcgccggccaacggcaccctggagcgctaccgcctccaggagacgctctccttc
atctcctcggagctccacaagggcttcagcccgctcttcaatcccgccctcccggaggct
gccgggcagttgacgcgcgagcggctggccctgcggctgggacacgctgagtccgtggtg
gcgaagcaggcgttcatcgccggcgaccagttcaccatcgcggatgcctacctcttcacc
gtgctcaactgggccggtcacacgaaggtggacctgacgcccttccccgcgctgcgcgcc
taccacgcccgcgtggccgagcgccccgccgtgcaggaggccctgaaggccgaaggtctc
gtgaagtga

DBGET integrated database retrieval system