KEGG   Myxococcus hansupus: A176_002063Help
Entry
A176_002063       CDS       T04077                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mym  Myxococcus hansupus
Brite
Enzymes [BR:mym01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A176_002063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKQ65151
UniProt: A0A0H4WNU9
LinkDB All DBs
Position
2436469..2437050
Genome map
AA seq 193 aa AA seqDB search
MPFTLPELPYKKDALQPHMSAETLEFHHDKHHAAYVNNLNKLLDGKAEANKSLEEIILSS
DGGVFNNAAQVWNHTFFWNCMKPAGGGKPTGELAAAIDRDFGSFDKFKEEFSTAAATQFG
SGWAWLVLEGGKLKVTKTGNADLPMKHGQKALLTIDVWEHAYYIDYRNLRPKFIETFLTH
LVNWDFVAQNLKG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcacgctgcctgaactgccgtacaagaaggacgcgctccagccgcacatgagc
gcggagacgcttgagttccaccacgacaagcaccacgccgcctacgtcaacaacctgaac
aagctcctggatggcaaggcggaggcgaacaagtcgctggaggagatcatcctcagcagc
gacggtggcgtcttcaacaacgccgcgcaggtgtggaaccacaccttcttctggaactgc
atgaagccggctggcggcggcaagccgacgggtgagctcgcggcggccatcgaccgtgac
ttcggctccttcgacaagttcaaggaggagttctccaccgcagcggccacgcagttcggc
tcgggctgggcctggctggtgctggagggtggcaagctcaaggtcaccaagacgggcaac
gccgacctgccgatgaagcacggccagaaggccctgctgaccatcgatgtgtgggagcac
gcctattacatcgactaccgcaacttgcgccccaagttcatcgagacgttcctgacgcac
ctcgtgaactgggacttcgtggcccagaacctcaagggctag

DBGET integrated database retrieval system