KEGG   Myxococcus hansupus: A176_002369Help
Entry
A176_002369       CDS       T04077                                 

Definition
(GenBank) Non-ribosomal peptide synthase
Organism
mym  Myxococcus hansupus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding
Motif
Other DBs
NCBI-ProteinID: AKQ65457
UniProt: A0A0H4XBX8
LinkDB All DBs
Position
2820965..2825560
Genome map
AA seq 1531 aa AA seqDB search
MSENIEPLAHRFPTLVDVLCQRAESQADALLYRFLETGDVDGPIEEWTYRRLDVRARSLA
ARLRELGAAGERALLLYPPGLEFVAGFMGCLYGGVIAVPCYPPDPTRLERTLPRLRAIAR
DCGARYVLTTSMILEMSEFLTPQAPELGELQWIATDAVPESEATAWKRPDLTADTLAFLQ
YTSGSTGNPKGVKVSHANILHNESLITRGFGLSSERSVGVGWLPMFHDMGLIGKVLQPLY
LGFPCVLMSPIAFLQRPMRWLEAISQFKGTCSGGPNFAFDLCARKARPDDVARLDLSHWD
LAFNGAEPVRRETMERFAETFAPAGFRREAFYPCYGLAEATLIVTGGTKGTPYVETRFDT
GSLELGQAKPVPGAAEGPSARTMVSSGPGAPDQRLLIVDPETRLPRGPHEVGEVWVSGPS
VAGGYWNRPEETAHAFDARLASGEGPFLRTGDLAFLSPEGELFITGRLKDLLIVRGRNLY
PQDLELTAERAHPAVRPGCSAAFAVEVDGEERLVLVSEVDVREGFDGAAVAGALRSALAD
EHQVRAHSVVLLQSRSIPKTSSGKIQRRACRDGFLSNTLEVVTLSAEETHEAPVAAPTGP
VRERLASAPAQERKALMEEFLRHEAARVLRAEPASLGADTSLASLGLDSLMALDLHGRLE
ESLGVSLPVAFLWQHPTLGAAAAHLLEAWGGAAVAPMGPALTAGSLEGELPLSPGQQRLW
FLDRLVPESALYNVHFQLRLSGPLDVSALGRALDSLLTRHAVLRASFPEMEGQPRQVVPA
ARPLELGREDLRALPAPEREAELGRLSRLQGEAPFQLAEGPLVRAALVALEDQEHVLLMT
QHHIVTDGWSIGVLARELAALYRAEVSGAAASLGAPAFQYVDYARWQQGLGNALDGQRAY
WARKLENLPRLELPTDFARPREPGFRGALHRFTLPASLVESLKAVGRAEGSTFFVTLAAA
WAALLHRYSGQDDFGLGTIFAQRDRAELRDVVGFFASTLVLRADVSGSPRFRELLGRMRS
TFHEALANADLPFEEVVGAARATRGGDNPLFQANLVLESLPPVDLDVPGMQWRPVLPVPD
GAVEGTAKFDLQLAVVETPRGLEGALEYRSDLFTPETAARLAGHLEALLRGIVASPDARV
EDLPLLDDAERRALLVDWNDFTSPLAQDPSLCIHAQFRARAALTPDAVAVVADDGSLTYA
ELARRATSLALHLRSLGVGPETRVGLCVERSVEMVVGMLGILEAGGAYVPLDPDYPRERL
TYMLEDSGARVLLTQSHLAGTLPSAGLRTVLLDDAASYPAGPGHAVDAGAMPDSPAYVIY
TSGSTGRPKGVVVPHGGVANFFAAMDVRVGHEPAGTWLAVTSISFDISVLELLWTLTRGF
KVVVQGDGASLKAPARAAGAGSGPWTSASSTSQMTRRRHTVRAATGCCWRARSSRTPTAS
RRCGRRSATSMPSAVCTRTPPWRARRSPLSPSAWPSGRAAWCCPCITRCAWRRSGRWWTT
CPAAVWASPWPRVGMRTTSSSPPRSTRSAAS
NT seq 4596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaacatcgagccgttggctcaccggtttcccactctcgtggacgtcttgtgc
cagagagccgaatctcaagccgacgcgctgctgtatcgcttccttgagacgggcgatgtc
gacggccccatcgaggagtggacctaccggcggctggatgtcagggctcgctcgctcgcg
gctcggctgcgcgaactcggtgcggcgggagagcgggcgctgctgctctacccgccaggg
ttggagttcgtcgcgggcttcatgggctgcctctacggcggcgtcatcgcggtgccatgc
tatccgccagaccccacgcggctggagcgcacgctgccccggctgcgagccatcgctcgg
gattgcggcgcgcgctacgtgctcacgacgagcatgattctggagatgtcggagttcctc
acgccccaggctcccgagctcggtgagcttcagtggatcgcgactgatgcggtgccggag
tccgaggccactgcgtggaagcgcccggacctgacggccgacacactggcttttttacaa
tacacgtcggggtccaccggcaaccccaagggcgtcaaggtcagccacgccaacattctg
cataacgagtcattgatcacccgtgggttcggattgtcctccgagcgctccgtgggcgtg
ggttggttgcccatgttccatgacatgggactcattgggaaggtgctacagccgctctac
ctgggcttcccttgcgtgctgatgtcacccatcgcgttccttcagcgccccatgcgctgg
ctggaggcgatttcccagttcaagggaacctgcagcggcggacccaacttcgcgttcgac
ctctgtgccaggaaggcccgtcccgatgacgtggcccgcctggatttgagccactgggac
ctggcgttcaacggcgcggagccggtgcggcgcgagacgatggagcgcttcgcggagacg
ttcgcgcccgcgggcttccggcgcgaggcgttctacccgtgctacggcctcgcggaggcg
acgctcatcgtcacgggtggcacgaagggcacgccctacgtggagacgcgcttcgacacg
ggctcgctggagctgggccaggcgaagccggtcccgggcgcggcggagggcccgtccgcg
cgcacgatggtgtcttctggtccgggggcgccggatcagcggctgctcatcgtcgacccg
gagacgcgcctgccgcgcgggccgcacgaggtcggtgaggtctgggtgtcggggcccagc
gtggcgggtggttattggaaccgtccggaggagacggcgcacgccttcgacgcgcggctc
gcgagcggggaggggcccttcctgcgcaccggcgacctggcgttcctctcgccggaaggc
gagctgttcatcaccgggcgactcaaggacctgctcatcgttcggggccgcaacctgtac
ccgcaggacctggagctgaccgccgagcgcgcgcaccccgcggtgcgtcccggctgcagc
gccgccttcgccgtggaggtggatggcgaggagcggctggtcctcgtctccgaggtggac
gttcgcgaagggttcgacggcgcggccgtcgcgggagcgcttcgcagcgcgctggcggat
gagcaccaggtgcgtgcgcactcggtggtgctgctccagtcccggagcattccgaagacg
tccagcgggaagattcagcgccgcgcctgccgtgatggcttcctgtccaacacgctggaa
gtggtgacgctctccgccgaggagacgcacgaggcccccgtggccgcgcccaccggcccc
gtgcgggagcggctggcgtccgcacccgcgcaggagcggaaggcgctgatggaggagttc
ctccgtcacgaggccgcccgcgtgctgcgcgccgagcccgcgtcgctgggcgcggacacg
tcgctggccagcctggggctggactcgctgatggcgctggaccttcacgggcgcctggag
gagtcgctgggcgtttcgctgcccgtggcgttcctctggcagcacccgaccctgggcgcg
gccgccgcgcacctgctggaggcctggggcggcgccgctgtcgcacccatgggccccgcg
ctgacggcgggctccctggagggcgagctgccgctgtcgcccggccagcagcgcctgtgg
ttcctggaccggctggtgccggagagtgcgctgtacaacgtccacttccagttgcgcctg
tccgggccgctcgacgtgtccgcgctgggccgcgccttggattcgctcctgacccgccac
gcggtgctgcgtgcgtccttcccggagatggaggggcagccgcgtcaggtggtgcccgcc
gcgcgcccgctggagctgggccgtgaggacctgcgtgcgttgcccgctcccgagcgcgag
gcggagctgggccggctgtcgcggctgcagggtgaggcgcccttccagctcgcggaaggg
cccctggttcgcgcggcgctggtggccttggaggaccaggagcatgtgctcctgatgacc
cagcaccacatcgtcacggatggctggtccatcggcgtcctggcccgggagctggccgcg
ctgtatcgcgcggaggtgtccggcgccgccgcgtcgttgggggcgcccgcgttccagtac
gtggactatgcgcggtggcagcagggcctggggaacgcgctggacggccagcgtgcctac
tgggcgcgcaagctggagaacctgccgcgtctggagctgcccacggatttcgctcggccg
cgtgagccgggcttccgcggcgcgctgcaccgcttcacgctgcctgcttcgctggtggag
tcgctcaaggcggtgggccgcgccgagggcagcaccttcttcgtcacgctggcggcggcc
tgggcggcgctgctgcaccgctacagcggccaggacgacttcgggctggggaccatcttc
gcccagcgcgaccgggccgagctccgtgacgtggtgggcttcttcgccagcacgctggtc
cttcgcgccgacgtgtcggggagcccgcggttccgcgagctgctcggtcgcatgcggagc
accttccacgaggccctggccaacgcggaccttcccttcgaggaggtcgtgggggccgcg
cgcgcgacgcgtgggggcgacaatccgctcttccaggcgaacctggtgctggagagcctg
ccgcccgtggacctggacgtgcccggcatgcagtggcgcccggtgctgcccgtgccggac
ggcgcggtcgagggcacggcgaagttcgacctgcagctcgcggtggtggagacgcctcgg
gggctggaaggcgcgctggagtaccgctccgacctcttcacgcccgagacggcggcgcgg
ctcgccgggcacctggaggcgttgctgcgaggcatcgtcgcgtctccggacgcgcgggtg
gaggacctgccgctgctcgacgacgcggagcgccgcgcgctgctggtggactggaacgac
ttcacctcgcccctggcgcaggacccgtcgctctgcatccacgcgcagttccgcgcccgg
gccgcgctgacgccagacgcggtggcggtggtcgcggacgacggctcgctcacctacgcc
gaactcgcgcgccgcgcgacctccctggcgctccacctgcggagtctcggggtggggccg
gagacgcgcgtgggtctgtgcgtcgagcgctcggtggagatggtggtggggatgctcggc
atcctcgaggccggcggcgcgtacgtgccgctggatccggactacccccgagagcggctc
acgtacatgctggaggactccggcgcgcgcgtgctgctgacccagtcgcacctcgccggc
acgctgccctccgcgggcctgcgcaccgtgctgttggatgacgcggcgtcgtacccggca
ggacctggacacgcggtggacgctggcgcgatgcccgacagtcccgcctacgtcatctac
acctcgggctccacgggacggcccaagggcgtcgtggtgccacacggcggcgtggccaac
ttcttcgcggccatggatgtgcgcgtgggccatgagcccgcgggcacgtggctggccgtc
accagcatctccttcgacatctccgtcctggagctgctgtggacgctcacgcgcggcttc
aaggtggtggtgcagggcgatggcgcgtcgctgaaggcgcccgcgcgtgcggccggggcc
ggcagcggcccatggacttcagcctcttctacttcgcagatgacgcggaggcgtcacacg
gtgagagcagctaccggctgctgctggagggcgcgaagttcgcggacacccacggcttcg
cggcggtgtggacgccggagcgccacttccatgccttcggcggtctgtacccgaacccct
ccgtggcgggcgcggcggtcgccgctgtcaccaagcgcgtggccatccgggcgggcagcg
tggtgctgcccctgcatcacccggtgcgcgtggcggaggagtgggcgctggtggacaacc
tgtccggcggccgtgtgggcatctccgtggcctcgggttggcatgcgaacgacttcgtct
tcgcccccgagaagtacgagaagcgccgcgagctga

DBGET integrated database retrieval system