Myxococcus hansupus: A176_005547 Help Entry A176_005547       CDS       T04077                                  Name (GenBank) DNA-binding protein HBsu   KO K03530   DNA-binding protein HU-beta Organism mym  Myxococcus hansupus Brite KEGG Orthology (KO) [BR:mym00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mym03032]     A176_005547    03036 Chromosome and associated proteins [BR:mym03036]     A176_005547    03400 DNA repair and recombination proteins [BR:mym03400]     A176_005547 DNA replication proteins [BR:mym03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A176_005547 Chromosome and associated proteins [BR:mym03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A176_005547 DNA repair and recombination proteins [BR:mym03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A176_005547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG MetW HU-CCDC81_euk_2 SpoIIIAH Motif Other DBs NCBI-ProteinID:  AKQ68635 UniProt:  A0A0H4X4W6 LinkDB All DBs Position 6918216..6918485 Genome browser AA seq 89 aa AA seqDB search MTKAELVEVVAAQTRLTKKSAAQILDIVFTNIGKAVKKDARFSYPGFGTWSVRSRKARKI RNPQTNEMMKLKASKTIGFRPAKELKNSL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccaaggcagaactcgtcgaggtggtggcggcgcagacacgtctcaccaagaagtca gcggcgcagattctcgacatcgtcttcaccaacatcggtaaggcggtgaagaaggacgcc cgcttcagctaccccggctttgggacctggtcggttcgctcgcgcaaggcgcgcaagatt cgcaacccccagacgaacgagatgatgaagctcaaggcgtcgaagaccatcggcttccgg cccgccaaggagctgaagaactcgctctga

DBGET integrated database retrieval system