KEGG   Myxococcus hansupus: A176_006062Help
Entry
A176_006062       CDS       T04077                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mym  Myxococcus hansupus
Pathway
mym00380  Tryptophan metabolism
mym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    A176_006062
Enzymes [BR:mym01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A176_006062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AKQ69150
UniProt: A0A0H4X6E7
LinkDB All DBs
Position
7521431..7522711
Genome map
AA seq 426 aa AA seqDB search
MTTPHPFEDTEAFAHKLDAEDALRGYRDAFHFPPTPEGKPVVYLAGNSLGLQPRNAARYI
QEELEDWARLGVEGHVHGRHPWLHYHELVTEQAARLVGAKPLEVVVMNTLSVNLHLMMVS
FYRPTKQRFKILVEGGAFPSDQYAVASQVRYHGYDAREAVMELKPRAGEETLRTEDILET
IERHGDEVALVMLGSVNYLTGQSFDLPAITQAAHAKGCFVGFDLAHGAGNLKLSLHDDGP
DFAVWCSYKYLNAGPGALGGVFVHERHANTKDLPRFEGWWGHDKKTRFQMGPTFEPLPGA
EGWQLSNPPIFQLAALRASLELFDQAGIGALRAKSERLTGYLEFLLDRLPEGYVRITTPR
DAKQRGAQLSLRFRGEPQGLLKRMGEAGIICDFRKPDIIRAAPAPLYNSFTDVYRFVKAL
EGYARE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccgcaccccttcgaggacaccgaggccttcgcccacaagctcgacgcggag
gacgcgctgcgcggctaccgcgacgcgttccacttcccgcccacgccggagggaaagccg
gtggtgtacctggcgggcaactcgctggggctccagccgcgcaacgccgcgcgctacatc
caggaggagctggaggactgggcccggctgggcgtggagggccatgtccacggccgccac
ccgtggctgcactaccacgagctcgtcacggagcaggcggcgcggctggtgggcgccaag
ccgctggaagtcgtggtgatgaacaccctgtcggtgaacctgcacctgatgatggtgtcg
ttctaccggcccacgaagcagcgcttcaaaatcctggtggagggcggcgccttcccgtcg
gaccagtacgccgtcgcctcgcaggtgcgctaccacggctacgacgcgcgcgaagcggtg
atggagctcaagccccgcgcgggcgaggagacgctgcgcaccgaggacatcctcgagacg
attgaacgccacggcgatgaagtcgcgctggtgatgctcggcagcgtgaactacctcacc
ggacagtccttcgacctgccggcgattacccaggccgcgcacgcgaagggctgcttcgtc
ggcttcgacctggcgcacggcgcgggcaacctgaagctgtccctgcacgacgacggaccg
gacttcgcggtgtggtgctcgtacaagtacctcaacgccgggccgggcgcgctgggcggc
gtgttcgtccacgagcggcacgcgaacacgaaggacctgccccgcttcgagggctggtgg
ggccacgacaagaagacgcggttccagatgggccccaccttcgagccgctgccgggcgcc
gaagggtggcagctctccaacccgcccatcttccagctcgcggcgctgcgcgcgtccctg
gagctgttcgaccaggccggcatcggcgcgctgcgcgccaagagcgagcggctcaccggc
tatctggagttcctgctggaccggctgcccgagggctacgtgcgcatcaccacgccgcgc
gacgcgaagcagcgcggcgcgcagctctccttgcgcttccggggtgagccccagggcctg
ctgaagcggatgggcgaggcgggcatcatctgcgacttccgcaagccggacatcatccgc
gcggcgcccgcgccgctctacaactccttcacggacgtctaccggttcgtgaaggccctg
gaaggctacgcccgtgagtga

DBGET integrated database retrieval system