KEGG   Myxococcus hansupus: A176_007197Help
Entry
A176_007197       CDS       T04077                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mym  Myxococcus hansupus
Pathway
mym00564  Glycerophospholipid metabolism
mym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A176_007197
Enzymes [BR:mym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A176_007197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Thi4 GIDA 3HCDH_N Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKQ70285
UniProt: A0A0H4X9M0
LinkDB All DBs
Position
8850755..8852452
Genome map
AA seq 565 aa AA seqDB search
MRSESVALTRVVPEAEVPPPPSRAARLRTLATEDFDVLIIGGGVTGAGSARDAALRGLKV
ALVEREDFASGTSSRSSRLIHGGLRYLEHGHLGLVFESSIERQRLLRLAPHLVRPLAFIW
PVYAGARVPRWKLNAGLMLYDALSLFRNVKGYRRLNARQVHAAEPGLRTEHLKGGARYYD
AATDDARLTLANAVGASEAGATVLNHASVKGLVLEGGQVRGATVLDHLTGEEVTVRARAI
VNATGPWSDEIRRLDAPDGTSPAVRGSKGVHLAVPRARLNHRDAFTLLSPKDGRVMFVLP
ADNFTIIGTTETSTRAHPAEVRASESDVAYLLESANAFFPEAHLTREDVVSAWAGIRPLV
ASGYHGAQADAGSASREHAIDVSPSGVLAISGGKLTTYRVMARDVVDAVERRLGIPRRRS
PTESLPLPGGDIRNLDAEFAAARVEIGDEATAHHLVRAYGSRWRRVWALTFEDTALARPL
AEGLPYRAAEAAWGVTHELVHSLSDLLIRRLKVAFETRDQGHAAARVAAEVMAPRLGWDA
AETQRQLDVYAADALRIFGVDPAEA
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
gtgcgttccgaatctgtcgcgctcacccgtgtcgtccccgaggccgaagtgcctccccct
ccgtcgcgcgccgcgcgcctgcgaaccctggccaccgaggacttcgatgtcctcatcatc
ggtggcggcgtcacgggggcgggctcggcgcgggatgccgcgctccggggcctcaaggtg
gcgctcgtcgagcgagaagacttcgccagcggcacctccagccggtcctcgcgcctcatc
cacggcggcctgcgctacctggagcacggccacctgggcctcgtcttcgagtccagcatc
gagcgtcagcgcctgctgcggctcgccccgcatctggtgcggccgctcgccttcatctgg
cccgtgtacgcgggcgcccgcgtgccccgctggaagctcaacgcgggcctcatgctctac
gacgccctgtcgctgttccggaacgtgaagggctaccggcggctcaacgcccgtcaggtc
cacgcggccgaaccgggcctgcgcaccgagcacctcaagggcggcgcccgctactacgac
gccgccaccgacgacgcgcgcctcacgctggccaacgccgtgggcgcctccgaggcgggc
gccaccgtgctcaaccacgcgtccgtgaaggggctcgtgctcgaaggcggccaggtgcgt
ggcgccacggtgctggaccacctcacgggtgaggaggtcaccgtgcgggcccgcgccatc
gtcaacgccacgggcccctggagcgacgagattcgcaggctggacgcgcccgatggcacg
agccccgcggtgcgtggcagcaagggcgtgcacctcgccgtgccgcgcgcgcggctcaat
caccgggatgccttcacgctgctgtccccgaaggacggccgggtgatgttcgtgctgccc
gcggacaacttcaccatcattggcaccacggaaacgtccacgcgcgcgcaccccgcggag
gtccgcgccagcgagtcggacgtggcctatctgctggagtccgccaacgccttcttcccg
gaggcgcacctcacccgtgaggacgtggtgagcgcctgggccggaatccgtccgctcgtg
gccagcggctatcacggcgcgcaggccgacgcgggcagcgccagccgggagcacgccatc
gacgtgagcccgtccggggtcctggccatcagcggcggcaagctcaccacctaccgcgtg
atggcgcgcgacgtggtggacgcggtggagcgccgcctggggattccacgccgccgctct
cccacggagtcgctgccgctccccgggggtgacatccgcaacctggacgccgagttcgcc
gcggcccgcgtcgaaatcggagacgaggccacggcccaccacctggtgcgggcctatggc
agtcgctggcgccgggtgtgggcgttgaccttcgaggacacggcgttggcccggccgctc
gcggaggggctgccctaccgagcggccgaggccgcctggggtgtcacccacgagctggtg
cattcgctgtccgacctgctcatccgccgcctcaaggtggccttcgagacgcgcgaccag
ggccatgccgccgcgcgcgtggcggcggaagtcatggcgccccggctgggctgggacgcc
gcggagacgcagcggcagttggatgtctacgccgccgatgcgctccgcatcttcggggtg
gaccccgccgaggcgtga

DBGET integrated database retrieval system