KEGG   Myxococcus hansupus: A176_007568Help
Entry
A176_007568       CDS       T04077                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mym  Myxococcus hansupus
Pathway
mym00071  Fatty acid degradation
mym00280  Valine, leucine and isoleucine degradation
mym00281  Geraniol degradation
mym00310  Lysine degradation
mym00362  Benzoate degradation
mym00380  Tryptophan metabolism
mym00410  beta-Alanine metabolism
mym00640  Propanoate metabolism
mym00650  Butanoate metabolism
mym00903  Limonene and pinene degradation
mym00930  Caprolactam degradation
mym01100  Metabolic pathways
mym01110  Biosynthesis of secondary metabolites
mym01120  Microbial metabolism in diverse environments
mym01130  Biosynthesis of antibiotics
mym01200  Carbon metabolism
mym01212  Fatty acid metabolism
Module
mym_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A176_007568
   00650 Butanoate metabolism
    A176_007568
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A176_007568
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A176_007568
   00310 Lysine degradation
    A176_007568
   00380 Tryptophan metabolism
    A176_007568
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A176_007568
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A176_007568
   00281 Geraniol degradation
    A176_007568
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A176_007568
   00930 Caprolactam degradation
    A176_007568
Enzymes [BR:mym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A176_007568
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A176_007568
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A176_007568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C 2-Hacid_dh_C NAD_Gly3P_dh_N UDPG_MGDP_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKQ70656
UniProt: A0A0H4X4M5
LinkDB All DBs
Position
9286570..9288747
Genome map
AA seq 725 aa AA seqDB search
MSEQSTIRWEQDADGIVVLTLDDPNQSANTMNAAYLKSMRATVDRLVKEKDSLSGVVITS
AKKTFFAGGDLKDLLKVKKEDAKQSFELGQEIKAQLRALETLGKPVVAAINGAALGGGLE
IALACHRRIVADVKGVQVGLPEVTLGLLPGGGGVVRTVRMLGIVDALMKVLLQGQRYRPQ
EAKDVGLVHEVVDSVEALLPAAKAWVKANPSAQQPWDVKGYKIPGGTPSHPGLAANLPAF
PANLRKQIKGANMPAPRAIMAVAVEGTQVDVDTAFTIESRYFTELVTGQVAKNMIQAFFF
DMQHINSGGGRPKGFPQYAAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLASAEKGK
QYSVKLVEKAIQRGKSTKEKGDALLARITPAADPAALKGCDVVIEAVFEDVKLKHQVFQE
VQDVVAPDALLASNTSTLPISLLAEGVKRTDDFVGMHFFSPVDKMPLLELIAGKKTSDAA
LAKAIDIAVQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGIAPASIEQAGLQAGYP
AAPLSLMDELTLTLPRKIRQETKAAAVAEGKPWAEHGSYAVVDALIDQHQRKGRSTGGGF
YDYEDGKRAGLWKGLAQHFTKPGHTIPFEDMKDRMLFAEAVDTVRCFDEGVLRSAADANI
GSILGIGFPAWTGGVAQFINGYEGPTGTGLRGFIARARELAAKYGPHFEPPASLVEKAEK
GELLK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagagcaccatccgctgggaacaagacgcagacggcatcgtggtcttgacg
ttggatgacccgaaccagtccgcgaacaccatgaacgccgcgtacctgaagtccatgcgc
gcgacggtggaccggctggtcaaggagaaggacagcctctccggcgtcgtcatcacctcc
gcgaagaagacgttcttcgccggtggcgacctgaaggacttgctgaaggtgaagaaggag
gacgccaagcagtccttcgagctgggccaggaaatcaaggcgcagctccgcgccctggag
acgctgggcaagccggtggtcgcggccatcaacggcgcggcgctgggcggtggtctggag
attgccctcgcgtgccaccgccgcatcgtggcggacgtgaagggcgtccaggtgggcctg
cccgaggtgacgctgggcctgctgcccggcggcggcggcgtggtgcgcaccgtgcgcatg
ctgggcatcgtggatgcgctgatgaaggtgctgctccagggccagcgctaccgcccgcag
gaggcgaaggacgtcgggctggtccacgaggtggtggactccgtggaggcgctgctgccc
gccgccaaggcgtgggtgaaggccaatcccagcgcgcagcagccgtgggatgtgaagggc
tacaagattccgggcggcacgccgtcgcaccccgggctcgcggccaacctgcccgccttc
ccggccaacctgcgcaagcagatcaagggcgcgaacatgcccgccccccgcgccatcatg
gcggtggcggtggagggcacgcaggtggacgtggacaccgcgttcaccatcgagtcgcgc
tacttcaccgagctcgtcaccgggcaggtcgcgaagaacatgattcaggcgttcttcttc
gacatgcagcacatcaactctggcggtggccggcccaagggcttcccgcagtacgcggcg
aagaaggtgggcgtgctgggcgccggcatgatgggcgcgggcatcgcctacgtctgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctcgcctcggcggagaagggcaag
cagtactccgtcaagctggtggagaaggccattcagcggggcaagtccacgaaggagaag
ggtgacgcgctgctggcgcgaatcaccccggccgcggaccccgccgcgctgaaggggtgc
gacgtcgtcatcgaggccgtcttcgaggacgtgaagctcaagcaccaggtgttccaggag
gtgcaggacgtggtggcgccggacgcgctgctcgcgtccaacacgtccacgctgcccatc
tccctgctggccgagggcgtgaagcgcaccgacgacttcgtgggcatgcacttcttctcc
cccgtggacaagatgccgttgctggagctcatcgctgggaagaagacgagcgacgcggcg
ctggcgaaggccatcgatatcgcggtgcagattgggaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcatcggcaccttcctcaacgaggccatcgccatg
gtgggcgagggcatcgcgccggcctccatcgagcaggcgggcctccaggcgggctacccc
gccgccccgctcagcttgatggacgaactcacgctgacgctgccgcgcaagattcgtcag
gagacgaaggcggccgccgtggcggagggcaagccctgggcggagcacggcagctacgcc
gtggtggacgcgctcatcgaccagcaccagcgcaagggccgctccacgggtggcggcttc
tacgactacgaggacggcaagcgcgcgggcctgtggaagggcctggcgcagcacttcacc
aagcccggccacaccatccccttcgaggacatgaaggaccggatgctgttcgccgaggcc
gtggacacggtgcgctgcttcgacgagggcgtgctgcgctcggccgcagacgcgaacatc
ggctccatcctgggcattggcttccccgcctggacgggcggcgtggcgcagttcatcaac
ggctacgagggcccgacgggcacgggcctgcgcggcttcatcgcccgcgcgcgggagctg
gcggcgaagtacgggccgcacttcgagccgcccgcgtcgctggtggagaaggcggagaag
ggcgagctgctgaagtag

DBGET integrated database retrieval system