KEGG   Mycobacterium sp. NRRL B-3805: MyAD_00005Help
Entry
MyAD_00005        CDS       T05013                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
myn  Mycobacterium sp. NRRL B-3805
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMO03843
LinkDB All DBs
Position
142..1206
Genome map
AA seq 354 aa AA seqDB search
MRLPVMPPVSPMLAKPVREIPPGASYEPKWDGFRSILFRDGDEVELGSRNERPLTRYFPE
LVAAARAELPPRCVVDGEIVIAGNTGLDFEALQLRLHPAVSRVTKLATETPAAFIAFDLL
ALGDEDLTGQPFSRRRSALTAALTDRGPTFHLTPATTDEGTAARWFTDFEGAGLDGLIAK
PLDGVYQPDKRVMFKVKHARTADCVVAGYRLHKSGDDAIGSLMLGLYGDDGSLASVGVIG
AFTMARRRELFHELQPLVTTFDEHPWNWAAHVPVEPTVRRTANSRWNPDKSLSFTPLRPE
RVVEAKYDQLEGKRFRHTAQFGRWRPDRDPRSCTFEQLEVPTSFRLADIVPGLG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcccgtcatgccaccggtgtcgccgatgctggccaaacccgtgcgcgagata
ccgcccggtgcatcatatgaaccgaaatgggacggcttccggtccatcctgttccgcgac
ggcgacgaggtggagctgggcagccgcaacgagcggccgctgacgcgctacttccccgaa
ctcgtcgccgcggcccgcgcagagttgccgccgcggtgcgtggtcgacggtgaaatcgtc
atcgccggcaacacaggactcgatttcgaggcgctgcagttgcggctgcatcccgcggtg
tcgcgggtgaccaagctggctaccgagaccccggcagcgttcatcgccttcgacctgctc
gcactcggtgacgaggacctgaccgggcagcccttcagcaggcgccgatcggcactgacc
gcggcactgaccgaccgcggacccaccttccacctcaccccggcgaccaccgacgaaggc
accgcggctcgctggttcaccgacttcgaaggcgccgggttggacgggttgatcgccaaa
ccgctcgacggcgtctaccaacccgacaagcgagtcatgttcaaggtcaagcacgctcgc
acggcggactgcgtggtggccggatatcgattgcacaagtcgggcgatgacgccatcggt
tcgctgatgctcggcctctacggcgacgatggttcgctggcatcggtcggagtcatcggg
gcgttcaccatggcgcgccgccgcgagttgttccacgaattgcagccactggtgaccact
ttcgacgagcacccgtggaattgggcggcgcatgtcccggtcgagccgacagtccgccgt
actgcgaactcacgctggaatccggacaagagcctgtcattcaccccgttgcgacccgag
cgggtggtcgaggcgaagtacgaccagttggagggaaagcggtttcggcacaccgcccag
ttcggtaggtggcgcccggaccgtgatccgcggtcgtgcaccttcgagcaactcgaggtt
ccgacaagcttccgcctcgcggacatcgtgccaggattgggttga

DBGET integrated database retrieval system