KEGG   Mycobacterium sp. NRRL B-3805: MyAD_06075Help
Entry
MyAD_06075        CDS       T05013                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00071  Fatty acid degradation
myn00280  Valine, leucine and isoleucine degradation
myn00281  Geraniol degradation
myn00310  Lysine degradation
myn00360  Phenylalanine metabolism
myn00362  Benzoate degradation
myn00380  Tryptophan metabolism
myn00410  beta-Alanine metabolism
myn00627  Aminobenzoate degradation
myn00640  Propanoate metabolism
myn00650  Butanoate metabolism
myn00903  Limonene and pinene degradation
myn00930  Caprolactam degradation
myn01100  Metabolic pathways
myn01110  Biosynthesis of secondary metabolites
myn01120  Microbial metabolism in diverse environments
myn01130  Biosynthesis of antibiotics
myn01212  Fatty acid metabolism
Module
myn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MyAD_06075
   00650 Butanoate metabolism
    MyAD_06075
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MyAD_06075
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MyAD_06075
   00310 Lysine degradation
    MyAD_06075
   00360 Phenylalanine metabolism
    MyAD_06075
   00380 Tryptophan metabolism
    MyAD_06075
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MyAD_06075
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MyAD_06075
   00281 Geraniol degradation
    MyAD_06075
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MyAD_06075
   00627 Aminobenzoate degradation
    MyAD_06075
   00930 Caprolactam degradation
    MyAD_06075
Enzymes [BR:myn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MyAD_06075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AMO04821
LinkDB All DBs
Position
complement(1284610..1285323)
Genome map
AA seq 237 aa AA seqDB search
MTATYAVHEAVATITLDDGKVNALSPAMQAAINTAFDQAAADVAAGTVKAVVLAGNGRVF
SAGFELSVFASGDADAGYGMLRGGFELALRVLTFPAPVVMASTGPAIAMGSFLMLTGDHR
VGSVKSRFQANEVAIGMVIPQAALEIMRMRLTPPAYSRAVSVAAVFAGDAAIDAGWADEI
VEHEAVLGRAQEIGAEYAATLNLKAHLASKVKARQIGIDAIQAGIDGLAEEYKKSVS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacctatgccgtgcacgaagccgtcgccaccatcaccctggacgacggcaag
gtcaatgcgctctcaccggcgatgcaggccgccatcaacaccgcgttcgatcaggcggcc
gccgatgtcgccgccggaaccgtcaaggccgtggtgctggcgggtaacgggcgggtgttc
agcgccggtttcgaactcagcgttttcgcctccggcgatgccgacgccgggtacggcatg
ctgcgcggcggattcgaactggcgttgcgggtgctgaccttcccggccccggtggtgatg
gcctcgaccgggcccgcgatcgccatgggatcgttcctgatgctgaccggcgaccaccgg
gtcggatcggtgaagtcgcgcttccaggccaacgaggtggccatcggcatggtcatcccc
caggccgccctggagatcatgcggatgcggctgactccgccggcctattcgcgggcggta
tcggtggccgcggtgttcgccggcgacgcggcgatcgacgccggctgggccgacgagatc
gtcgagcacgaggccgtgctgggtcgcgcccaggagatcggcgccgagtacgccgccacc
ctgaacctgaaggcccacctggccagcaaggtcaaggcccgccagatcgggatcgacgcg
atccaggccggtatcgacgggctggccgaggagtacaagaagtcggtcagctag

DBGET integrated database retrieval system