KEGG   Mycobacterium sp. NRRL B-3805: MyAD_07910Help
Entry
MyAD_07910        CDS       T05013                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00564  Glycerophospholipid metabolism
myn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MyAD_07910
Enzymes [BR:myn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MyAD_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 Pyr_redox 3HCDH_N AlaDh_PNT_C HI0933_like Thi4
Motif
Other DBs
NCBI-ProteinID: AMO05119
LinkDB All DBs
Position
1669853..1671592
Genome map
AA seq 579 aa AA seqDB search
MTDPISGNGQAQLGPAQRATAWERLGSEQFDVVVIGGGVVGAGAALDAATRGLRVALVEA
RDYASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPLTK
RVWERPYIAAGIFLYDQLGGAKSVPAQKHLLKAGALRLAPGLKRSSLIGGIRYFDTVVDD
ARHTMMVARTAAHYGAVVRTSTQVVALLREGDRVTGVRVRDTENGAVTEVHGHVVVNATG
VWTDEIQALSKERGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWIIG
TTDTDWNLDLAHPAATKADIDYILGHVNSVLATPLTHDDIDGVYAGLRPLLAGESESTSK
LSREHAVAVPSPGLVAIAGGKYTTYRVMGADAIDAAAEFVPTRVAPSITEKVPLVGADGY
FALVNQTEHVGAHYDLHPYRVRHLLDRYGSLISEVLTMADGKPELLEPITAAPVYLKVEA
VYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAETVAPVLGWSEADIDREVATYL
ARVEAEVRSQTQPDDESADALRAAAPEARAEILEPVPLT
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacccgatttctggcaatggtcaagctcaactcggtccggcccagcgcgcgacg
gcctgggaacgactcggcagcgaacagttcgacgtcgtcgtcatcggcggtggcgtcgtc
ggtgccggtgccgccctggacgctgcgacccgtgggttgagggtggcgctggtcgaggcg
cgtgattacgcctcgggcacgtcgagccgcagctccaagatgttccacggtggcctgcgc
tacctggagcaactggagttcggcctggtacgcgaggcgctgcacgagcgtgagctctcg
ctgacgaccctggccccgcatctggtgaaaccgttgccattcctgttccccctcaccaaa
cgggtctgggagaggccctacatcgcggcgggcatctttctctacgatcagctcggtggc
gcgaaatccgttccggcgcaaaaacatctgctcaaggccggagcgttgcggctggcccct
ggcctcaagcgcagctcgctgatcggcggcatccgatacttcgacaccgtcgtcgacgac
gcccgccacaccatgatggtggcccgcaccgcggcgcactacggcgctgtggtgcgcacc
tcgacccaggtcgtggcgctgctgcgggagggcgaccgggtgaccggtgtgcgggttcgc
gacacggagaatggcgcggtcaccgaggtgcacgggcatgtcgtggtgaacgcgaccggg
gtgtggaccgacgagatccaggcgttgagcaaggagcgcggacggttccgggtgcgggcc
tccaagggcgtgcacatcgtggtcccgcgtgatcgcatcgtcagcgaggtggcgatcatc
ctgcgcaccgagaagtcggtgttgttcgtgatcccgtggggcacacactggatcatcggg
accaccgataccgactggaatctcgacctggcccacccggcggccacgaaggccgatatc
gactacatcctcggtcacgtcaactcggtgctcgccactccactgacccatgacgatatc
gacggcgtctatgccggtctgcgtccgctgctggccggtgagagcgagtccacctcaaaa
ctgtcccgcgaacacgcagtggcggtgccctcgccggggctggtggccattgcgggcggc
aagtacaccacctaccgggtgatgggtgccgacgccatcgacgccgcagccgaattcgtg
ccgacccgggtggcgccgtcgatcaccgagaaggtgccgctggtcggcgccgacggctat
ttcgcgttggtgaaccagaccgaacacgtgggtgcccattatgatctgcacccctaccgg
gtgcggcatctgctggaccggtacggctcgctgatcagtgaggttttgacgatggcggac
gggaaacccgaactgctggaaccgatcacggctgcaccggtgtacctgaaggtggaggcg
gtctacgccgccgccgccgaaggcgcgctgcatctggaggacatcctggcccgtcggatg
cggatctcgatcgagtatccgcaccggggtgtggactgtgcccgcgaagtcgccgaaacc
gttgcgcccgttctcggttggagcgaggcggatatcgaccgcgaggtggcgacctatctg
gcgcgggtggaggccgaggtgcgctcgcagacccaaccggacgacgagtccgccgatgcc
ctacgggcggcagccccggaggcgcgcgcggagatcctggaaccggtgccgctcacttga

DBGET integrated database retrieval system