KEGG   Mycobacterium sp. NRRL B-3805: MyAD_10530Help
Entry
MyAD_10530        CDS       T05013                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00473  D-Alanine metabolism
myn00550  Peptidoglycan biosynthesis
myn01100  Metabolic pathways
myn01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MyAD_10530
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MyAD_10530
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MyAD_10530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:myn01011]
    MyAD_10530
Enzymes [BR:myn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MyAD_10530
Peptidoglycan biosynthesis and degradation proteins [BR:myn01011]
 Precursor biosynthesis
  Amino acid ligase
   MyAD_10530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST UDPGT
Motif
Other DBs
NCBI-ProteinID: AMO05552
LinkDB All DBs
Position
2254680..2255777
Genome map
AA seq 365 aa AA seqDB search
MSARTRVAVVYGGRSSEHGISCVSAGSILRNLDPERFEVVAVGITGDGSWVLTDGRPEAL
AITDGRLPVVADGTALALTADPVRRGELLSLGEGAGAVLAAVDVVFPVLHGPYGEDGTIQ
GLLELAGVPYVGAGVLASATGMDKEFTKKLLVADGLPIGDHVVLRSHQDTVSLDDRERLG
LPVFVKPARGGSSIGVSRVTAWDQLPQAIAEARRHDPKVIVEAAIIGREVECGVLEFPDG
RVEASEIGEIRVAGVRDREDTFYDFATKYLEDAAELDVPAKVDDEVADALRALAIRAFRA
IDCQGLARVDFFLTENGPVINEINTMPGFTTISMYPRMWAASGLDYPTLLATMVETAVAR
GTGLR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcccgtacccgagtcgccgtcgtctatggcggacgcagctccgagcacgggatt
tcctgtgtttccgcaggcagcatcctgcgcaatctcgatccggaacgcttcgaggtggtc
gccgtcggcatcaccggcgacggatcgtgggtgctgaccgatggcaggcccgaggcgttg
gccatcaccgatggccgcttgcctgtcgttgccgacggcaccgcgctcgcgttgaccgcc
gacccggtgcgccgcggtgagctgttgtccctgggcgagggagccggtgcggtattggcc
gccgtcgatgtcgtctttccggtgctgcacggtccctacggcgaggacggcaccatccag
ggcctgttggagctggccggggtgccctatgtcggggccggggtgctggccagcgccacc
gggatggacaaggaattcaccaagaagctcctcgtcgccgacggactgccgatcggggac
cacgtcgtgttgcgatcgcatcaggacaccgtgagcctcgatgaccgtgagcggcttggt
ctcccggtattcgtgaagcctgcgcgcggcggttcgtcgatcggggtgagccgggtgacg
gcatgggatcagttgccccaggcgatcgccgaggcgcgccgccacgaccccaaggtgatc
gtcgaggccgccatcatcggccgcgaggtcgagtgtggtgtgctcgagttccccgacggc
cgcgtcgaggccagtgagatcggtgagatccgggtcgccggcgtgcgcgaccgcgaggac
accttctacgacttcgccaccaagtatctggaggatgcggccgagctcgacgtgccggcc
aaggtcgacgacgaggtggccgacgcactgcgcgccctggcgatccgggcgttccgggct
atcgactgtcagggtttggcgcgggtcgacttcttcctcaccgaaaacggtccggtgatc
aacgagatcaacacgatgccgggattcaccaccatctcgatgtatccgcggatgtgggcg
gccagcgggctggactacccgacactgctggcgacaatggtcgagaccgcggtcgcccgc
ggcaccggcctgcgctga

DBGET integrated database retrieval system