KEGG   Mycobacterium sp. NRRL B-3805: MyAD_12980Help
Entry
MyAD_12980        CDS       T05013                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00620  Pyruvate metabolism
myn00680  Methane metabolism
myn01100  Metabolic pathways
myn01120  Microbial metabolism in diverse environments
myn01200  Carbon metabolism
Module
myn_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MyAD_12980
  09102 Energy metabolism
   00680 Methane metabolism
    MyAD_12980
Enzymes [BR:myn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MyAD_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMO05947
LinkDB All DBs
Position
2767847..2770642
Genome map
AA seq 931 aa AA seqDB search
MADSTDSTLEPIGSVQRTNVGREATEPMREDIRLLGAILGDTVREQNGDNIFDLVEKARV
ESFRIRRSEIDRAELADLFRDIDVHQAIPVIRAFTHFALLANVAEDIHRERRRAVHEAAG
EPPQDSSLAATYRKLDGAQLDASVVTAALTGALVSPVITAHPTETRRRTVFDTQHHITEL
MRLRLHGHTRTDGGRDIETELRRHILTLWQTALVRLSRLKISDEIETGLRYYPAAFLDVI
PRVNAEVRDALQQRWPGTQVLAQPILRPGSWIGGDRDGNPNVTAEVVRLATGRAAYTAFD
HYFGEICALEQELSLSSRLVRTSQEMTALADACAEPARSDEPYRRALRVIHARLTATAMR
ILDDQPALELDLGLEPYETPEQLLADLDTVDASLRDNGSAVLADDRLGRLREAVRVFGFH
LSGLDMRQNSEVHEQVISELLAWAGVHPDYASLPEEARVELLAAEIGTRRPLVGPGAELS
ELAAKELGIVRAAARAVKVFGPQAIPNYIISMCQSVSDMLEAAVLLKEAGLLDATAGAVY
APVGIVPLFETIDDLQRGSAILEAALDLPVYRALVTARGDQQEVMLGYSDSNKDGGYLAA
NWALYRAELDLVDSAQRTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVKGSLRITEQ
GEVIAAKYAEPRIAHRNLETLLAATLESTLLDVEGLGEDAEDAYRVLDDLAARAQRAYAE
LVHETPGFVEYFKASTPVSEIGALNIGSRPTSRKPTTAISDLRAIPWVLAWSQSRVMLPG
WYGTGTAFEQFVAGDDTKLEILRDLYNRWPFFRTVLSNMAQVLSKSDLGLAARYSELVAD
EELRARVFDKIVDEHERTVRMHGLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELL
RRYRSGDDDELVQRGILLTMSGLASALRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggcagacagcaccgacagcactctggaacccatcggctcggtgcagcgcaccaacgtc
ggtcgcgaagccaccgaaccgatgcgagaagatatccggctgctcggcgcgattctcggt
gacacggtccgggaacagaacggcgacaacatcttcgacctcgtcgaaaaggcgcgggtc
gagtctttccggatacggcgctccgagatcgaccgtgccgagctggccgatctgttccgc
gatatcgacgtccatcaggcgatcccggtcatccgcgcgttcacccacttcgccctgttg
gccaatgtcgcggaggacatccaccgtgagcgtcgtcgcgccgtacacgaggccgccggg
gagccaccgcaggacagcagcctggccgccacctatcgcaaactcgatggcgcccaactg
gacgcgagcgtggtcaccgcggcattgaccggtgcgctggtgtccccggtgatcaccgcg
caccccaccgagacccgccgccgcacggtcttcgacacccagcaccacatcaccgaactg
atgcggttgcggctccacgggcacacccgcaccgacggtggccgggacatcgaaaccgaa
ctgcgcaggcacatcctcacgttgtggcagacggcgttggtccggctgtcgcgcctgaag
atctccgacgagatcgaaaccgggctgcggtactacccggctgcgttcctggatgtcatc
ccacgggtcaacgccgaggtgcgggacgcgctgcagcaacgttggccgggcacacaggtg
ctggcacaaccgatcctgcggccgggatcctggatcggcggcgaccgcgacggtaacccc
aacgtcaccgccgaggtggtacggctggccaccgggcgcgccgcctacacggccttcgac
cactacttcggcgagatctgcgcgctggaacaggaactgtcgttgtcctcgcggctggtg
cgaacaagccaggagatgaccgcgctcgccgatgcctgtgccgaacccgcccgcagcgac
gagccctaccgtcgggccctgcgggtgattcacgcccggctgaccgctaccgccatgcgc
atcctcgatgaccagcccgcactcgagctcgacctcggtctggagccctacgagactccc
gagcagttgttggcagatctggataccgtggacgcgtcgttgcgtgacaacggctccgcg
gtgctggccgatgatcggctgggtcggctccgggaagcggtgcgggtgttcggttttcac
ctgtccggtctggacatgcggcagaactccgaggtgcacgagcaggtgatctccgagttg
ctggcctgggcgggtgtccatccggactatgcctcgctgcccgaggaggcgcgggtcgaa
ttgttggccgccgagatcggcacccgccgtccgctggtcgggcccggcgcggagttgtcc
gaactggccgccaaggagctcggcatcgtccgggccgccgcccgggcggtgaaagtgttc
gggccacaagccattccgaactacatcatctcgatgtgccagtcggtatcggacatgctg
gaagccgcggtcctgctgaaagaggccggactgctcgatgccaccgccggcgccgtctac
gcaccggtgggcatcgtcccgttgttcgagacgatcgatgacctgcagcgcggctcggcc
attctggaggccgcgttggacctcccggtctatcgggcgttggtgaccgcacgcggtgac
caacaggaggtcatgctcggctattcggattccaacaaggacggtggatacctggcggcc
aactgggcgctctaccgcgccgagctggacctggtggactcggcgcagcggaccggaatc
cggttgcggctcttccacggtcgcggtggcaccgtcggtcgtggtggtggcccgagttac
gacgccatcctggcccagccgcccggtgcggtgaagggatctctgcgcatcaccgaacag
ggtgaggtgatcgccgccaagtacgccgagccgcggatcgcccaccgcaacctggagacc
ttgctggctgccaccctggagtcgaccctgctggatgtcgaggggttgggggaggacgcc
gaggacgcctaccgcgtgctcgacgacctggcggcccgtgcccagcgcgcctacgccgaa
ttggtgcacgagacaccggggttcgtcgagtacttcaaggcctcgactccggtgagtgag
atcggcgcgctcaacatcggcagccggccgacctcgcgcaagccgaccaccgcgatctcg
gatctgcgggccatcccgtgggtgctggcctggagccaatcccgggtgatgctgccgggc
tggtacggcaccggcaccgccttcgaacagttcgtcgccggtgacgatacgaagctggag
atcctgcgcgacctctacaaccgatggccgttcttccgcactgtgctgtcgaatatggcg
caggtgctgtcgaaatcggatctcggtctggcggcccgctattcggagttggtcgccgat
gaggagctgcgggccagggttttcgacaagatcgtcgatgagcacgagcggaccgtccgc
atgcatggactgatcaccggccaggatgacctgcttgccgacaacccggcgttggccagg
tcggtgttcaaccggttcccgtacctggaaccgctgaatcacctgcaggtggaattgttg
cgccgataccggtccggggacgatgacgaactggtgcaacgcggcatcttgctgacgatg
agcgggttggccagcgctctgcgcaactcgggatag

DBGET integrated database retrieval system