KEGG   Mycobacterium sp. NRRL B-3805: MyAD_19330Help
Entry
MyAD_19330        CDS       T05013                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
myn  Mycobacterium sp. NRRL B-3805
Pathway
myn00010  Glycolysis / Gluconeogenesis
myn00020  Citrate cycle (TCA cycle)
myn00620  Pyruvate metabolism
myn01100  Metabolic pathways
myn01110  Biosynthesis of secondary metabolites
myn01120  Microbial metabolism in diverse environments
myn01130  Biosynthesis of antibiotics
myn01200  Carbon metabolism
Module
myn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:myn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MyAD_19330
   00020 Citrate cycle (TCA cycle)
    MyAD_19330
   00620 Pyruvate metabolism
    MyAD_19330
Enzymes [BR:myn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     MyAD_19330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C DXP_synthase_N Transketolase_N
Motif
Other DBs
NCBI-ProteinID: AMO06967
LinkDB All DBs
Position
complement(4141724..4142791)
Genome map
AA seq 355 aa AA seqDB search
MAVISAPLQLVGADGAPTAETRYRRDLPPETLSWLYELMVLTRELDTEFVNLQRQGELAL
YASCRGQEAAQIGAAASLRKTDWLFPQYRELGAFLTRGISPAQMGAVWRGSWHGGLSFTE
RCCAPISIQIGTHGLHAVGAAMAAQRLDEDSVTVAFMGDGATSEGDAHEALNLAAVFAAP
TVFFIQNNQFAISTPERRQHAATSLADRAAGYGMPAVRVDGNDVLACFAVMSEAAQRARD
GGGPTFIEAVTYRMGPHTTSDDPTRYRADADVQDWAARDPIARYTAYLRATGVLTDRLAE
RVAGRAARLRTDLRKALIGAPDPDIAEVFDTVYHDITPELARQREELLIELGKES
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcatttctgcacccctacaactggtcggtgccgatggcgccccgaccgccgag
acgcgatatcgacgcgatcttccaccggaaacgctgagctggctctatgagctgatggtg
ctgacccgcgaactcgataccgagttcgtgaacctgcagcgccagggcgagctcgcgctc
tatgcgtcctgtcgcgggcaggaggcggcgcagatcggtgcggcggcaagcctgcgcaag
accgattggctgtttccgcagtaccgcgagctcggcgcgttcctgacccgcggtatctca
cccgcacagatgggtgcggtgtggcgagggtcctggcacggcggcctgtcgttcaccgag
agatgttgcgcgccgatctccattcaaatcggcacccacggattgcacgccgtcggtgcc
gcgatggccgcccaacgcctcgacgaggactcggtgacggtggctttcatgggggacggc
gccacctccgagggcgatgcgcacgaggcgctgaacctggccgcggtgttcgctgcgccc
accgtgttcttcatccagaacaaccagttcgccatctcgacgccggagcgccgccagcat
gcggccacctcgctggccgaccgggccgccggctacggcatgcccgcggtccgcgtcgac
ggcaatgacgtgctggcctgcttcgccgtcatgtccgaggccgcccagcgtgcccgcgat
ggtggtggcccgacgttcatcgaggcggtcacctatcggatggggccgcacaccacctcc
gacgaccccacccgctaccgcgccgacgcggacgtccaggactgggcggcccgcgacccg
atcgcccggtacaccgcgtacctgcgagcgaccggggtgctgaccgaccgactcgccgag
cgggttgccggcagggcggcgcggctgcgcacggacctgcggaaggcgctgatcggcgcg
cccgatcccgatatcgccgaggtgttcgacaccgtctaccacgacatcaccccggagttg
gcccgccaacgcgaggagttgctcatcgagctggggaaggagtcctga

DBGET integrated database retrieval system