KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_00170Help
Entry
OEM_00170         CDS       T02732                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Brite
KEGG Orthology (KO) [BR:myo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:myo01001]
    OEM_00170
Enzymes [BR:myo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     OEM_00170
Protein kinases [BR:myo01001]
 Serine/threonine kinases: Other
  Bacterial family
   OEM_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Kinase-like Pkinase_fungal Haspin_kinase RIO1 ABC1
Motif
Other DBs
NCBI-ProteinID: AGP61553
UniProt: S4Z1H0
LinkDB All DBs
Position
complement(18717..19970)
Genome map
AA seq 417 aa AA seqDB search
MTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAVKVLKQEFSQDPEFIERFRAEARTTA
MLNHPGIAAVHDYGESQLDGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTG
RALQVAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAP
EQALGHDATPSSDVYSLGVVGYEVVSGKRPFTGDGALTVAMKHIKEPPPPLPAELPPNVR
ELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQSPPPGRASPAAIPSSPTTRAA
AVSPRSAAPRRSRPTTGGHRPPPARRTFSSGQRALLWAAGVLGALAIIIAVLIVINSRGD
QQQQPPTVTDTGTPPASAPPPTNTPSGSAGMRLEWPDDGTIGMSGFRGGPAGHGTSQ
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgtctggcagataccgcctgcagcgcctgatcgccaccggcggcatgggtcag
gtctgggaggccgtggacagccgcctgggccgacgcgtcgcggtcaaggtgctcaagcag
gagttctcccaagaccccgagttcatcgagcgcttccgcgctgaggcgcggaccacggcg
atgctcaatcaccccgggatcgcggcggtccacgattacggcgagagccagctggacggg
gagggccgcaccgcctacctggtgatggagctggtcaacggcgagccgctgaactcggtg
ctcaaacgcaccggccggctctcgctgcggcacgccctggacatgctcgagcagaccggt
cgcgcgctgcaggtcgcgcacgccgccgggctggtccaccgcgacgtcaagccgggcaac
atcctgatcaccccgaccggccaggtgaagatcaccgacttcggcatcgccaaggccgtc
gacgccgcgccggtgacccagaccggcatggtcatgggcaccgcccaatacatcgcgccc
gaacaggcgctcgggcacgacgccaccccgtccagtgacgtgtactcgctgggagttgtt
ggctacgaggttgtttcgggcaagcggccgttcaccggtgacggcgccctgaccgtggcg
atgaagcacatcaaggaacccccgccgccgctgcctgcggagctgccgcccaacgtgcga
gaactcatcgagatcacgctggtcaagaacccggcgatgcggtaccgcagcgggggaccg
ttcgccgacgccgtcgcggcggtgcgcgccggtcgccgtccgccccgccccagccagtca
ccgcctccgggccgggcctcgccggcggcgataccgtccagcccgacgacccgggcggcg
gcggtgtccccgcgcagcgcggcgccgcgtcgatcccgccccaccaccggcgggcaccgc
ccgcccccggcccggcgcaccttctcgtcggggcagcgcgcgctgctctgggccgccggg
gtactcggcgcgctggcgatcatcatcgcggtgctcatcgtcatcaattcccggggggat
cagcagcaacagcccccgacggtcaccgacaccggcaccccgccggcatcggcgcccccg
ccgaccaacaccccgagcggttcggcaggcatgcgtctcgagtggccggatgacggcacg
atagggatgtcgggattccgcggtgggccggcgggacacgggacatcgcaatga

DBGET integrated database retrieval system