KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_03290Help
Entry
OEM_03290         CDS       T02732                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
myo  Mycobacterium intracellulare subsp. yongonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AGP61865
UniProt: S4Z4N7
LinkDB All DBs
Position
complement(333203..334258)
Genome map
AA seq 351 aa AA seqDB search
MPPVSPMLAKSVRAIPPHASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPELVAAV
RAELPERCVIDGEIVIATDHGLDFEALQQRIHPADSRVRMLAEATPASFIAFDLLALGGD
DYTRRPFSERRAALVDAVGGSGRSIHVTPATTDLGTAQRWFDEFEGAGLDGVIAKPLDVT
YQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASVGVIGAFPMA
ERRRLFTELQPLVTDFADHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVPLRPERVVEV
RYDHMEGRRFRHTAQFNRWRPDRDPRSCTYQQLEQPVTFSLGEIVPGLGPG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggtgtcgccgatgctggccaagtcggttcgcgctatcccgccccacgcgtcg
tacgagcccaagtgggacggattcaggtcgatctgtttccgtgacggcgacgacgtcgag
ctcggcagccgcaacgagcggccgatgacccgctactttccggagttggtcgccgcggtc
agggccgagctgccggagcgctgcgtgatcgacggggagatcgtcatcgccaccgaccac
ggcctggacttcgaggcgctgcagcaacgcattcacccggccgactcgcgggtgcgaatg
ctcgccgaggcgacgcccgcgtccttcatcgcgttcgacctgctggcgctcggcggcgac
gactacacccggcggccgttcagtgagcggcgggcggccctcgtcgatgcggtgggcgga
tcgggtcgctcgatccatgtcacgcccgcgacgaccgatctgggcaccgcgcagcgatgg
ttcgacgagttcgagggcgccggcctcgacggcgtgatcgccaagcccctggacgtcacc
taccagccggacaagcgggtgatgttcaagatcaagcacgaacggaccgcggactgtgtg
gtcgccggctatcgggtgcacaagtccggcgccgacgcgatcgggtcgcttttgctgggg
ctctaccaggacgacggccagctcgcgtccgtcggcgtcatcggcgcgttcccgatggcc
gagcggcgccggctgttcaccgaattgcagccgctcgtcaccgacttcgcggaccatccg
tggaactgggccgcccacgaggccggcgagcgaacgccccgcaagaacgaatactcgcgg
tggaacgccggcaaggacctctcgttcgtgccgctgcggcccgagcgcgtggtcgaagtc
cgctacgaccacatggagggtcggcgttttcgtcataccgcgcagttcaatcggtggcgt
ccggaccgcgacccgcgctcgtgcacctaccagcagctggaacagccggtgacgttcagc
ctcggcgagatcgtgccgggcctcggcccgggctaa

DBGET integrated database retrieval system