KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_04570Help
Entry
OEM_04570         CDS       T02732                                 

Definition
(GenBank) hypothetical protein
Organism
myo  Mycobacterium intracellulare subsp. yongonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C PI31_Prot_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: AGP61993
UniProt: S4Z2H8
LinkDB All DBs
Position
complement(456346..457359)
Genome map
AA seq 337 aa AA seqDB search
MRASVLRDGRMVYRDDVPDPIPEAGQVLVGVRACGICGSDLHFAAHGAQVLEMTERAAGG
GGGMHVDLDHDIFMGHEFSAEILEAGPDTETHPPGTLVTSLPVLLSAKGVEPIVYSNSTI
GGYSERMLLSAPLLLPVPNGLDFKHAALTEPMAVGLHAVNKSNVAPGETALVLGCGPIGI
AIVAALRSKGVETIVAADFSPKRRELATAMGAHQTLDPAQGSPFDSVKPAVVFEAVGVPG
IIDDVLLRARPGTRLVVAGVCMQPDTVHPFFAIAKEINVQFVLAYTPDEFGDSLRALADG
DIDVSPLITGEVGLDAVGAAFDDLADPERHCKVLVTP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctcggtgttgcgcgacggtcgcatggtctaccgcgacgacgtgcccgacccg
atccccgaagccgggcaggtgctcgtcggcgtgcgggcatgcggaatctgcggcagcgac
ctgcatttcgccgcccacggcgcccaggtgctggaaatgaccgaacgggcggccggtggc
ggcggtggcatgcacgtcgacctggaccacgacatcttcatgggtcacgaattcagcgcc
gagatactcgaagcgggccccgacaccgagacccatccaccgggcaccctggtcacctcg
ctgccggtgctgttgtccgccaagggcgtcgagccaattgtgtacagcaacagcacaatc
ggcggctactccgaacggatgctgttgtccgcgccgctgctgctgcccgtccccaatggc
ctagacttcaaacacgcagcactgaccgaacccatggcggtgggattgcatgccgtcaac
aagtccaacgtcgcgcccggggagacggccctggtactgggctgcggcccgatcgggatc
gccatcgtcgccgcccttcggtccaagggcgtcgaaaccattgtggcggcggacttttca
ccgaagcgacgggagctcgccactgcgatgggagctcaccagacgctggatccggcgcag
ggctcgcccttcgacagtgtcaagcccgcggtggtgttcgaggccgtcggggtgcctggc
atcatcgacgacgtgctgctccgcgcgcggccgggcactcgactggtggtcgccggggtg
tgcatgcaacccgacacagtgcatcccttcttcgcgatcgccaaagagatcaacgtgcag
ttcgtgctcgcctacacccccgacgagttcggcgactcgttgcgcgcgctggccgacggc
gacatcgacgtcagcccgctgatcaccggcgaggtgggcctggatgcggtcggggcggcg
ttcgacgacctggccgaccccgagcggcactgcaaggttctcgtcacgccctga

DBGET integrated database retrieval system