KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_29110Help
Entry
OEM_29110         CDS       T02732                                 

Definition
(GenBank) DNA polymerase LigD ligase subunit
Organism
myo  Mycobacterium intracellulare subsp. yongonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AGP64446
UniProt: S4ZA35
LinkDB All DBs
Position
3109924..3110922
Genome map
AA seq 332 aa AA seqDB search
MTDFASLPGAVREALYDEPVPDWRSPTLATLTDDRFSDPHWIFERKFDGMRCLAFRDGDR
VRLLSRNRQPLNGTYPELVDALAAQPVTRFVVDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVRVFYYVFDLLHLDGMSTVEVPLLWRKRLLRRAIDFGDPLRCAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQSGRSKNWLKFKCVRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLVYAGKVGTGFDDATLRRLHARLSPITRDTPPFVRGLVREAGANWVSPEMVVQIG
FSEWTRDGKLRHPRYLGMRTDKEPGDVVRETH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttcgcgagcctgccgggtgcggtgcgcgaagcgctgtacgacgaacccgtg
cccgactggcgctcgccaaccctggccaccctcaccgacgaccggttctccgatccgcac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggcgttccgcgacggcgatcgg
gtgcggctgttgtcgcgtaatcgtcagccgctcaatggaacctatcccgaattggtggat
gcgcttgccgcccaaccggtcacgcggttcgtcgtggacggagaggtggtggccttcgac
ggccgacggaccagcttcgcacggctgcagggtcggctgggcctcaccgaccccgacgtg
gcccgggcgtcgccggtgcgtgtcttctactacgtgttcgatctgctgcatctcgacggc
atgtccaccgtcgaggtgccgctcctgtggcgaaagaggttgctgcgcagagcgatcgac
ttcggcgacccgctgcgctgtgcgccgcaccgcgtcggggacgggatcgccgcctaccgg
cgcgcatgtgaacgcggggacgagggagtgatcgccaagcgggccgactccacctaccag
agcggtcgctcgaagaactggctgaagttcaaatgcgtgcgcgatcaggagttcgtggta
gggggctacaccagtcccaagggcagtcgcgtcgagttgggcgccctgatgctcggctac
tacgagggcggcgacctggtctacgcgggcaaggtcggcaccggtttcgacgacgccacg
ctgcgccggctgcacgcgcgcctgtcgccgatcacccgggacacgccgccgttcgtccgc
ggtttggtgcgcgaggccggcgcgaactgggtatcccccgagatggtggttcagatcgga
ttcagcgagtggacgcgcgatggcaagttgcgccatccgcgctacctcggcatgcgcacc
gacaaggagcccggcgacgtggtgcgggagacgcactga

DBGET integrated database retrieval system