KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_29120Help
Entry
OEM_29120         CDS       T02732                                 

Definition
(GenBank) putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
myo  Mycobacterium intracellulare subsp. yongonense
Pathway
myo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:myo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    OEM_29120
Enzymes [BR:myo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     OEM_29120
DNA repair and recombination proteins [BR:myo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     OEM_29120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha_TIF
Motif
Other DBs
NCBI-ProteinID: AGP64447
UniProt: S4ZH15
LinkDB All DBs
Position
3110922..3111812
Genome map
AA seq 296 aa AA seqDB search
MARVDVEITHPDRVLFPADGITKRDLAAYYDQVADTMLTHLRGRALNVQRYPRGIAETGF
IQQDFADSLPDWMSSVRVAKEGGTVEHPVVERPEALRWLANQSCITLHMWQSRRARLDNP
DRLVFDLDPSDGDFAVVRATARATAGILGDLGLACYVQTTGSRGLHVVAPLRADTDFDTA
RQFAREVSEVVAADDPAHRTVEARKGKRDGRVYLDIMRNAYAQTAVAPYSVRARNGAPVA
TPLEWDELDAGRLRADRFTIRDVPKRLAGQPDPWAHMTRHARSLAGPMRRLARLRA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgtcgacgtcgagatcacccacccggaccgcgttctgtttcccgccgacggg
atcacgaaacgcgatctcgccgcctactacgaccaggtggccgacaccatgttgacgcac
ctgcggggccgggccctcaacgtgcagcgctatccccgcggcatcgccgaaacagggttc
atccagcaggatttcgccgattcgctacccgactggatgagtagtgtccgggtggccaag
gagggcggcaccgtcgagcatccggtcgtcgaacggccggaggcgctgcgatggctggcc
aatcaaagctgcatcaccctgcacatgtggcagtcgcgccgggcccggctggacaacccg
gaccggctcgtcttcgacctcgatccgtccgacggcgacttcgccgtggtgcgagcgacc
gcacgcgccacggccgggatactcggggacctgggcctggcgtgctacgtccagaccacc
ggctcgcgcgggttgcacgtcgtggctcccttgcgcgccgacaccgatttcgacaccgcc
cggcagttcgcccgcgaggtcagcgaagtggtcgccgcggacgatcccgctcatcgcacc
gtggaggctcgcaagggcaagcgcgacggacgggtctatctcgacatcatgcgaaacgcc
tacgcgcagacggcggtcgcgccgtattcggttcgggcccgcaacggcgcgccggtagcc
accccgctggaatgggacgagctggacgcggggcggttgcgggccgaccggttcaccatc
cgagacgttcccaaacggcttgccggacaaccggatccgtgggcgcacatgacgcggcac
gcccgctcactggccggcccgatgcggcgattggcgaggctgcgtgcctga

DBGET integrated database retrieval system