KEGG   Mycobacterium intracellulare subsp. yongonense: OEM_47300Help
Entry
OEM_47300         CDS       T02732                                 

Definition
(GenBank) metabolite/sugar transport protein
Organism
myo  Mycobacterium intracellulare subsp. yongonense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 TRI12 PASTA MFS_1_like PIRT
Motif
Other DBs
NCBI-ProteinID: AGP66265
UniProt: S4ZI66
LinkDB All DBs
Position
complement(4981129..4982676)
Genome map
AA seq 515 aa AA seqDB search
MAADPTDREWWSEAGDDAPTAANGRHREAELRDGTDPAKCADAAHEEASHGAAGAGAEAG
NQLTSAVVVIALVSAISGMLYGYNTGVISWALLLLTEEFNITAAWKQVVAASILLGAIIG
ALACSWLSDRFGRRGTLLMLSVVFIVGALWCADAPDVVVLSLGRLVLGFAVGGATQTAPM
YVAELSPTAYRGRLVLCFQIAIGVGILVANLVGISDSVSWRGPTGIACVPAAIMLWLLLR
LPESPRWLVKRGDRNAARAVLERVRPDGYDVGAELDEATELARMERQATTRGWAGLRDAW
VRPALVLGCGIAVFTQLSGIEMIIYYAPTILTNSGVYRSMALLVSLALGATYVIAQLVGL
AIIDRVGRRRLTLIMVPGAAISLFALGLLFVTADSGHDVIAQIMICLIAFMVFNAGGLQL
MGWLTGSETYPLAVRPEGTAVHSATLWGTNLLITLTLLSLINAIGPGPSMWLYALFNVAA
WIFVFFRMPDLTGKSLEEIEKNLAEGKFRPSDFSR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgatcccacagaccgcgaatggtggtcagaagccggcgatgacgccccgacc
gcggcgaacgggcggcatcgcgaggcggaattgcgcgatgggaccgacccggcaaagtgc
gcagatgcggctcacgaggaagcgtcgcacggtgcagccggcgccggcgcggaggcggga
aaccaactgacgagcgccgtggtcgtcatcgccctcgtctcggcgatctcgggcatgctc
tacggctacaacaccggtgtcatctcctgggccctattgctgctcaccgaggagttcaac
atcaccgcggcctggaagcaggtggtcgccgccagcatcctgctcggcgccatcatcggg
gcattggcgtgcagctggctttccgatcggttcggccgccgcggcaccctgttgatgctg
tcggtggtgttcatcgtcggcgcgctgtggtgtgccgacgcgccggatgtcgtggtgctg
tcgctgggaaggctggtcctgggcttcgcggtcggcggggcgacgcagaccgcaccgatg
tatgttgccgagctttcgccgacggcctaccgggggcggttggtgctgtgcttccaaatc
gccatcggggtgggcatcctggtcgccaacctcgtcgggatctccgactcggtctcctgg
cgggggccgaccgggatcgcgtgcgtccccgccgcgatcatgttgtggctgttgctgcgc
ctaccggaaagtccgcgctggctggtcaagcgaggcgatcgaaacgctgcacgagccgtg
ttggagcgggtccggcccgacggctacgacgtgggtgccgagctggacgaggcgaccgaa
ctcgcgcgcatggaacgccaggccactacccgcgggtgggctgggctgcgcgacgcgtgg
gtgcgtccggcgctggtgctgggttgtggcatcgcggtgttcactcagctcagcggcatc
gagatgatcatctattacgcgccgaccatattgaccaacagcggtgtgtacaggtccatg
gctctgctggtgtcgctggcgttgggtgcgacgtacgtgatcgcccaactggttgggttg
gccattatcgaccgggtcggccggcgccggctcaccctcatcatggtgccgggtgcagcg
atcagcctgttcgcgctcggcctgctcttcgtcaccgccgacagcggtcacgatgtgatc
gcccagatcatgatctgcctgatcgccttcatggtgttcaacgccggcggcctgcagctg
atgggatggctgaccggctcggagacctatccgctggcggtgcgaccggagggcaccgcc
gtgcattcggcgacgctgtgggggaccaacctgctcatcacgctgacgctgctgtcgctc
atcaatgcgatcgggcccggcccctcgatgtggctctacgcgctgttcaacgtggcggcg
tggatcttcgtgttcttccgcatgcccgacctcaccggtaaaagcttggaggaaatcgaa
aagaatctggcggaggggaaatttcgaccttcagacttctcgcgatga

DBGET integrated database retrieval system