KEGG   Myroides sp. A21: MYRA21_0034Help
Entry
MYRA21_0034       CDS       T03521                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
myr  Myroides sp. A21
Pathway
myr00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:myr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MYRA21_0034
Enzymes [BR:myr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MYRA21_0034
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MYRA21_0034
    1.1.1.-  
     MYRA21_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 adh_short HI0933_like 2-Hacid_dh_C 3HCDH_N FAD_binding_3 FokI_C FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AJA67279
LinkDB All DBs
Position
complement(38198..39265)
Genome map
AA seq 355 aa AA seqDB search
MSTMKAARWYAAKDIRVEQTEIPTPAKGQVKVAVQYAGICGSDLHEYVHGPQLIPLDKPY
PLNGHQGVTTLGHEFSGIVEELGEGVKNIKVGDRVVIEPIYKNFDSPFVASGEYNLGEHL
GFIGLAGNGGFAKYVVVEDYMIHKIPDTMSFEQGALVEPAAVAVYSVLQSGLKVGQTVLV
SGAGPIGLLCAQAALAAGASTVIVTDVAEKRLEKAKEIGATHVFNAMEADLPAKIKALTG
GLGVNVFLDCAGVQASYNTGIASTRNGGTAVLVALFGKPVQHDALDQVLREITVKGVIAY
RNIFPEVINLIDSGRMEVEKLVTNKIGLDEIVTNGFEALVSNPEQVKILIDINRA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaatgaaagcagcacgctggtatgcagccaaagatattagagtagaacaaaca
gaaatccctactccagctaaaggacaggtaaaagtagcagttcaatatgctggtatctgt
ggatcagacttacacgaatatgtacacgggcctcaattaattccattagacaaaccttat
ccattaaatggtcatcagggtgtaactactttaggacatgagttctcaggtatcgttgaa
gaattaggtgaaggtgtaaaaaatattaaagtaggggatcgtgtagtaattgagcctatc
tataaaaacttcgatagtccattcgtagcttctggagaatacaacttaggagaacactta
ggtttcatcggattagcaggtaatggaggatttgcaaaatacgtagtggttgaagattat
atgattcacaaaattcctgatacgatgtcttttgaacaaggtgctttagtagagcctgct
gcagtagctgtatactcagtactacagagtggtctaaaagtaggacagacagtattagta
tctggtgcaggacctatcgggttactatgtgctcaagcagctttagcagctggtgcgtct
actgtgatcgttacagatgtagcagagaaacgcttagagaaagcaaaagaaatcggagct
actcatgtattcaatgctatggaagctgatcttcctgctaagattaaagccttgactggt
ggtctaggagttaatgtattcttagattgtgctggagtacaagcttcttataatacaggt
attgcttctactcgtaatggaggtactgctgtattagttgctttattcggaaaaccagtt
caacacgatgctttagatcaagtattaagagagatcactgtaaaaggggttatcgcttat
agaaatatcttccctgaagtaattaacttaatcgactctggtcgtatggaggtagaaaaa
ttagtgacaaataaaattggtttagacgagattgtaacaaatggttttgaagccttagta
agcaatccagaacaagttaaaatccttattgatatcaatagagcataa

DBGET integrated database retrieval system