KEGG   Myroides sp. A21: MYRA21_1429Help
Entry
MYRA21_1429       CDS       T03521                                 

Definition
(GenBank) Arabinose efflux permease
Organism
myr  Myroides sp. A21
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 LacY_symp MFS_2 DUF5337
Motif
Other DBs
NCBI-ProteinID: AJA68587
LinkDB All DBs
Position
complement(1526150..1527376)
Genome map
AA seq 408 aa AA seqDB search
MKKIAQIYIDSYKGLSSASWMLAIVMLINRSGSMVLPFLGVYMTKELHFSQEQTGYVLAC
FGVGSIIGTTVGGWVTDKIGNYKVQYLSLIGSIPVFIMLPHFTSVVSLALMMLLQSAVSE
MFRPANSVAITMYAKPENITRAFSLNRMAVNLGFSIGPAMGGILAAISYALLFYVNATAA
FLAAVVFIYFFRNRKTNKELLLEQEDITELTEIEDVSNKSPYKDKMFLIYSVFCTLYSIA
FLQLLSTLPIFYEKAVGLDEVEIGLILGYSGLLIFLTEMLLVHVAEKFFTIRQTIFYGVM
ISALGYGMLAFDHSYISIYISMTILCVSEMLAMPFTSTVTAMRAGSKNKGAYMGVNGLTF
AIGFIISPILGTKVASTLGYDVLWLGTAALVIIAALGLNYSVKKMAEE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctcaaatctatatcgactcttacaaaggtttatcatcagcatcatgg
atgctagcaattgtaatgttaatcaatagatcggggtccatggtattgccattcttaggt
gtatatatgacgaaagaacttcactttagtcaagaacagacaggatatgtattagcttgt
tttggggtaggttctattataggaactacagtaggcggatgggtaactgataaaataggt
aactataaagtacagtacttgagcttaataggtagtattccagtatttatcatgttacca
cacttcacgtctgtagtcagtctagcactgatgatgttattacagagtgcagtcagtgaa
atgtttagaccggcgaactctgtagccatcaccatgtatgctaaacctgagaatatcacc
cgtgccttctctctaaatagaatggcagtgaacttagggttctctatagggcctgctatg
ggaggtattctagctgcgatatcgtatgcgctattattctatgtgaatgctactgcggcg
tttctagcagctgtcgtatttatttatttctttagaaatagaaagacgaacaaagaatta
ttattagaacaagaagatatcactgagctgactgagatagaagatgtctctaataaatct
ccatataaggataagatgttcttaatatacagtgtattttgtacgttatactctattgcc
ttcttacaactattaagtacactacctatattctatgagaaagctgtggggctagatgaa
gtagaaatagggcttatcttagggtacagtggtctactaatcttcttaacagagatgtta
ttagtgcatgtcgcagaaaaattctttacgatcagacagactatcttctacggggttatg
attagtgccttaggatacggaatgttagcttttgaccacagttatatctctatctatata
tcgatgacgatcttatgtgtctctgagatgctagcaatgccatttacctctacggtgaca
gcgatgcgtgctggtagtaagaataaaggtgcttatatgggcgtgaatgggttgaccttc
gctatcggatttattatttcacccatcctaggaacaaaggtagcttctactctagggtat
gatgtcttatggttaggtacagctgcattagtaatcatagctgctctagggctaaactat
tctgtcaaaaaaatggctgaagaataa

DBGET integrated database retrieval system