KEGG   Myroides sp. A21: MYRA21_1471Help
Entry
MYRA21_1471       CDS       T03521                                 

Definition
(GenBank) ADP-ribose pyrophosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
myr  Myroides sp. A21
Brite
KEGG Orthology (KO) [BR:myr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:myr03400]
    MYRA21_1471
Enzymes [BR:myr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     MYRA21_1471
DNA repair and recombination proteins [BR:myr03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    MYRA21_1471
 Prokaryotic Type
    MYRA21_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AJA68629
LinkDB All DBs
Position
1569368..1569865
Genome map
AA seq 165 aa AA seqDB search
MSTTAVPLGIKRIATLCVLRNGNNFMLLKRLKEPNKDTYTPVGGKIEPFETPEEGVIRET
FEETGIRVDKVKFCGILTETSPVKYNWLSYVYVADIDAVTPPECNEGTLEWIAYEDLLNV
PTPKTDWFIYKYILENKPFVFHALYDGELNLLEMKEEISNEELGI
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaactgctgttccgttaggaataaaaagaatagcaacactgtgtgtgttgaga
aatgggaataactttatgcttctaaagcgtttaaaagaacccaataaagatacgtatact
cctgtgggaggtaagatagaacctttcgaaactcctgaagagggggtgatccgtgagaca
tttgaagagacagggataagagtagataaggtgaagttctgcggaatactgacagagact
tctcctgtgaagtataattggctaagctatgtgtacgtagcagatatcgatgctgtcact
cctcctgagtgtaacgagggaactttagagtggatagcgtatgaggacttgctaaatgta
cctactccgaagacagattggtttatttataaatacatcttagagaataagccttttgtg
tttcatgcattatacgatggagagttgaatctgttagagatgaaggaggagatttctaat
gaggaattaggaatttag

DBGET integrated database retrieval system