KEGG   Myroides sp. A21: MYRA21_1663Help
Entry
MYRA21_1663       CDS       T03521                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
myr  Myroides sp. A21
Pathway
myr00020  Citrate cycle (TCA cycle)
myr00310  Lysine degradation
myr00380  Tryptophan metabolism
myr01100  Metabolic pathways
myr01110  Biosynthesis of secondary metabolites
myr01120  Microbial metabolism in diverse environments
myr01130  Biosynthesis of antibiotics
myr01200  Carbon metabolism
Module
myr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
myr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:myr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYRA21_1663 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    MYRA21_1663 (sucA)
   00380 Tryptophan metabolism
    MYRA21_1663 (sucA)
Enzymes [BR:myr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MYRA21_1663 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AJA68813
LinkDB All DBs
Position
1769719..1772490
Genome map
AA seq 923 aa AA seqDB search
MDRYSFLNAAHTAFFADLYDQYLESPDSVEPSWRAFFQGFDFANEYNGGPVEQLSQAYTS
SNSVGVDSSAQLGQLQKEFAVLKLIDAYRTYGHLLTKTNPLRDRKVEHPDLSLEKFGLSQ
ADLNVNFEAAKTIQLPTTTLGQIIAQLEKIYCTTLGIEYKYITDEAAVQWIQNHYEATEA
KFDSEEKKEILHKLIEAVSFENFLNTKYVGQKRFSLEGLEAAIPAMDFMMDAAAEKGVEE
IVVGMAHRGRLNVLANVFHKPAQDIFAEFDGKDYDAVEGFDGDVKYHLGLTSTRKTRSGK
EIHVNLTPNPSHLETVGAVIEGIARAKQDTIFVNEPSKVLPIALHGDAAIAGQGIVYEIV
QMAKLRGYKTEGTIHIVLNNQVGFTTNYSDGRSSTYSTDVAKVTQSPVLHVNADDTEAAV
RAFLFALDYRMHFGTDVFIDLVGYRKYGHNEGDEPKFTQPILYKLISKHPNSRNIYNARL
LEDKVVDDAFVKSLEKQYKDALEQELSTSREKEFAKVRTFMEENWDGFHIAGRDKMVADY
DTKVSKEKLTAIAEVITALPGDKKFINKVTRLIGDRKAMFFEKDALDWAMGELLAYGTLL
TDGYDVRMSGQDVERGTFSHRHAVVKTEDTEESIILLNQLKEQNGQMRIFNSLLAEYAVL
GFEYGYALTNPNTLTIWEAQFGDFSNGAQIMMDQYISAAEDKWSNQNGIVMLLPHGYENQ
GAEHSSARLERYLQLCAESNMFVTNVTTPANFFHLMRRQMITDFRKPLINMSPKSLLRHP
AAVSSISDFTDGKFQYVIDDANVNAADVKSVVLCSGKFYYDLVAKREELGRKDIAFVRIE
QLFPLPIEQIAEVLAKYTNADDFVWGQEEPRNMGAYGHMLMNFDLKPLRYAGNQAFSAPA
SGSSVRSKKRYAEAIAKVFDKNL
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggatagatattcctttttaaatgcggcacacactgcattttttgcagatttatatgat
caatatttagaaagcccagatagcgtagagccaagctggagagctttctttcagggattt
gactttgcaaatgaatacaatggtgggcctgttgagcaattatcacaagcttatacgtca
agtaatagtgttggtgtagatagttcagcgcagttagggcaacttcaaaaggagtttgct
gtattaaaattaattgacgcttacagaacttatgggcatttattgactaaaacaaaccca
ttaagagacagaaaagtagagcatccagatttgagtttagagaagtttggtctttctcaa
gcagatttgaatgttaattttgaggctgcaaaaacaatacaactaccaactactacattg
ggacaaatcattgcccaattagagaaaatttactgtactacattaggtattgagtacaag
tacatcactgatgaagctgctgtacaatggattcaaaatcactatgaggctacagaggca
aaatttgatagtgaagagaagaaagaaattctgcacaagttaattgaagcagtttctttt
gagaacttcctaaacacaaaatacgttggacaaaaacgtttctcactagaaggtctagaa
gctgcaataccagcgatggactttatgatggacgctgctgctgaaaaaggagtagaggag
atcgtagtagggatggcacaccgtggacgtcttaatgtattagctaacgtattccacaaa
cctgcacaagatatctttgctgaatttgacggtaaagattatgatgctgttgaaggtttt
gacggagacgttaagtatcacttaggtcttacatctacacgtaagactcgttctggaaaa
gagatccatgttaacttaactcctaacccttctcacttagagactgtaggggcagttatc
gaaggtatcgctagagcgaaacaagatactatctttgtaaacgaaccatctaaagtttta
cctatcgctcttcacggagatgctgcaatcgctggacaaggaattgtttatgaaattgta
cagatggctaaacttagagggtataagacagaaggtacaattcacattgtattaaacaac
caagttggttttacaactaactattctgatggtcgttcttctacttattctacagatgtt
gctaaagtaactcaatctcctgtattacacgttaacgctgacgatactgaagctgcagta
agagcattcttattcgctttagattaccgtatgcattttggtacagatgtatttattgac
ttagttggataccgtaaatacggacacaacgagggagatgaaccaaagttcactcaacca
atcttgtacaagttaatctctaaacaccctaactctcgtaatatctataacgctagatta
ttagaggataaagtggtagatgatgctttcgttaaatctttagagaaacaatataaagat
gctttagaacaagagttaagcacttctcgtgaaaaagaatttgctaaggttagaacattt
atggaagagaactgggatggattccacatcgcaggtcgtgacaaaatggtagctgactac
gacactaaagtttctaaagagaaattaactgcaattgctgaagtaattactgcattgcct
ggtgataaaaaattcatcaataaggtgacaagacttatcggagatagaaaagctatgttc
ttcgagaaagatgctttagactgggctatgggtgagttattagcgtatggtacattattg
acagatggatacgatgtgcgtatgtcaggtcaagatgtagagcgtggtacattctctcac
agacatgctgtagtgaaaacagaagatacagaagagtcaatcattttattaaaccaatta
aaagagcaaaatggtcaaatgagaatattcaactctctattggctgagtacgctgtttta
ggttttgagtatggttatgcattgactaatcctaatacattaactatctgggaagcacag
ttcggggatttctctaacggagctcagattatgatggatcaatatatctctgctgctgaa
gataaatggagcaaccagaacggtatcgtgatgttattacctcacggatatgaaaatcaa
ggtgctgaacactcttctgctagattagagcgttacttacagttatgtgctgaaagtaat
atgttcgtaacgaatgtaactactccagctaacttcttccacttaatgagaagacaaatg
atcactgactttagaaagccattaatcaatatgtctcctaagagtttattaagacaccca
gctgcggtatcttctatcagtgactttacagatggtaaattccaatacgtgatagacgat
gctaatgtaaatgctgcagatgtaaaatcagtagtattgtgtagtggtaagttctactac
gacttagtagctaagcgtgaagaattaggtagaaaggatattgcatttgttcgtatcgaa
caattattcccattaccaatcgagcaaattgctgaggtattagcgaagtatactaatgca
gacgacttcgtatggggtcaagaagagccacgtaacatgggtgcttatgggcatatgtta
atgaactttgacttgaaaccattgcgttatgcaggtaaccaagcatttagtgcaccagct
tcaggaagttctgtacgttctaaaaaacgttatgcagaagctatcgctaaagtgttcgac
aagaatttataa

DBGET integrated database retrieval system