KEGG   Mycobacteroides abscessus DJO-44274: NF92_05550Help
Entry
NF92_05550        CDS       T03534                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mys  Mycobacteroides abscessus DJO-44274
Pathway
mys00250  Alanine, aspartate and glutamate metabolism
mys00410  beta-Alanine metabolism
mys00430  Taurine and hypotaurine metabolism
mys00650  Butanoate metabolism
mys01100  Metabolic pathways
mys01110  Biosynthesis of secondary metabolites
mys01120  Microbial metabolism in diverse environments
mys02024  Quorum sensing
Module
mys_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NF92_05550
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NF92_05550
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NF92_05550
   00430 Taurine and hypotaurine metabolism
    NF92_05550
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NF92_05550
Enzymes [BR:mys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     NF92_05550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIV18218
LinkDB All DBs
Position
1152715..1154097
Genome map
AA seq 460 aa AA seqDB search
MNASAFSPAYTGRLSTAPVPALRLPDEPMDPQAAYRFIHDELMLDGSSRLNLATFVTTWM
DPEAEKLMAETFDKNMIDKDEYPATAAIESRCVAMVADLFHADNLSTEDPSSAVGVSTIG
SSEAVMLAGLALKWRWRAKIGGTDGTAWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLP
MAKGRYVITPEQVLEAVDEDTIGVVGILGTTFTGELEPIAAICAALDKLAATPGKPDVPV
HVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSKEHLPEDLV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYAQVMRCLSETARWFGDELGKS
EHFEVITDGSAIPVVSFRLKGKRPYTEFDISHSLRAFGWQVPAYTMPEDVTDIAVLRVVV
REGFSGDLARALRDDLNTVLKGLDELKPNGHFDEVQPFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atcaatgcctccgcgttcagccccgcgtataccggcaggctgtccacggcacccgtcccg
gcgctgcggctgcccgacgagccgatggatccgcaggccgcctatcggttcatccacgac
gagctgatgctcgacggcagctcgcggctgaacttggcgaccttcgtcacgacgtggatg
gatcccgaggccgaaaagctgatggccgagacattcgacaagaacatgatcgacaaggac
gagtatccggcgacggccgcgatcgagtcgcgatgcgtggccatggtggccgacctgttc
catgccgacaacttgtccacagaggatccgtcctcggcggtgggcgtgtcgaccatcgga
tcgagtgaggcggtcatgctggccgggctggccctcaagtggcgttggcgcgcgaaaatc
ggcggtaccgacggcaccgcctggaagggacgcacacccaacctggtgatgggttccaac
gtgcaggtggtctgggaaaaattctgccggtacttcgacgtcgaaccgagatacctgccg
atggccaagggccggtatgtgatcactcccgagcaggtgcttgaggcggtcgacgaggac
accatcggcgttgtcgggatcctgggcaccacgttcaccggagagctggagccgatcgcc
gcgatctgcgcggcgctggacaagctcgctgctacacccggcaagcccgatgtgcccgtg
cacgtcgatgccgccagcggtggtttcgtggtgcctttcctacatcccgaactgcactgg
gacttccggctgccgcgggtggtgtcgatcaatgtcagcggacacaagtacgggctgacc
tatcccgggatcggctttgtggtgtggcgcagcaaggagcatctgcccgaagacctggtg
ttccgggtcaactacctgggtggcgacatgccgaccttcaccctgaacttttcccgcccg
ggcaaccaggtggtggggcagtactacaacttcctgcgactgggccgggccggatatgca
caggtgatgcgctgtctgtcggagacggcacgctggttcggtgacgaactcggcaagagt
gaacatttcgaggtgatcaccgacgggtcggcgatcccggtggtgtcattccggctcaaa
ggcaagcggccgtacaccgagttcgacatctcgcattcgttgcgggcatttggctggcag
gtgcctgcgtacaccatgcccgaagacgtcaccgatatcgccgtgctgcgagtggttgtg
cgcgagggcttctcgggagatctggccagagcgctgcgcgatgatctcaacaccgtgctc
aagggactcgacgagctgaaaccgaacggacacttcgacgaggtgcagccgttcgcccat
tag

DBGET integrated database retrieval system