KEGG   Mycobacteroides abscessus DJO-44274: NF92_05945Help
Entry
NF92_05945        CDS       T03534                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mys  Mycobacteroides abscessus DJO-44274
Pathway
mys00564  Glycerophospholipid metabolism
mys01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mys00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NF92_05945
Enzymes [BR:mys01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NF92_05945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA 3HCDH_N NAD_binding_8 HI0933_like AlaDh_PNT_C Pyr_redox Thi4
Motif
Other DBs
NCBI-ProteinID: AIV15190
LinkDB All DBs
Position
1233037..1234818
Genome map
AA seq 593 aa AA seqDB search
MSDATSPSGSSGPTYTFLGPEARSLNWERLGSEQFDVIVIGGGVVGAGSALDAATRGLKV
ALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVQEALRERELSLSTLAPHLVKPLPFL
FPLTNRWWERPYVAAGIFLYDQMGGAKSVPAQKHLTRAGALRLAPGLKRNSLIGGIRYYD
TVVDDARHTMTVARTAAHYGAVVRASTQVVSLLREGDRVTGVLVRDTESGAETEVRGHVV
INATGVWTDEIQALSKTRGRFRVTASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGN
HWIIGTTDTEWNLDLAHPAATKVDIDYILDHVNTVLATPLTHNDIDGVYAGLRPLLAGEN
DDTSKLSREHAVAVAAPGLVAIAGGKYTTYRVMASDAVDMASEFVPARVAPSITEKVPLL
GADGYFALINQTEHVGETYGLHPYRVRHLLDRYGSLIGEVLACAGTDHSLLQPITKAPMY
LKVEALYAVAAEGALHLEDILARRMRIAIEYPHRGVECAQEVAELVAPVLGWSAEDIVRE
VDTYRARVDAEVRSQRQPDDASADALRVAAPEARSFIVEPVTETGTVLSPATK
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgcaaccagcccgtcggggtcgagtggacccacatacacgttccttgggccc
gaagctcgttcactgaattgggagcgcctgggatccgagcagttcgatgtgatcgtcatc
ggcggcggtgtcgtgggcgccggttcggcgctggacgcggcaacccgtggcctcaaggtc
gcgctggtagaggctcgtgactttgcgtcgggaacctcgagccgctcgtcgaagatgttc
cacggcggtctgcgctacctggagcagctcgaattcggattggtgcaggaggcgttgcgt
gagcgggagctgtccctctcgacgctggcaccgcacctggtcaagccgctgccgttcctg
ttcccgttgaccaacaggtggtgggagcggccgtacgtggcggcgggtattttcctgtac
gaccagatgggtggtgcgaaatctgttcctgcccaaaagcatctgacccgtgcgggcgcg
ctgcggctggcaccggggctcaagcgaaattcactcatcggcgggatccggtattacgac
acggtggtcgacgacgcccgtcacaccatgaccgtggcacgtacggccgcccactatggc
gcggtggtgcgcgcctccacacaggtggtctcgctgctgcgtgagggtgaccgtgtcacc
ggtgtgctggtgcgggatacggagagcggtgccgaaaccgaggttcgcgggcatgtcgtc
atcaacgcgaccggagtgtggaccgacgagatccaggcgctgtccaagacacgagggcgt
ttccgggtcacggcatccaagggcgtgcatatcgtggtgccgcgcgacagaatcgtcagc
gaggtcgcgatcatcctgcgtaccgagaaatcggtgctgttcgtgattccgtggggcaac
cattggatcatcggaaccaccgataccgagtggaatctggacctggcgcatcccgctgcc
accaaggtcgacatcgactacatcctggaccatgtgaacaccgtgttggcaacaccgttg
acgcacaacgatatcgatggggtgtacgcagggctgcggccattgctggcgggcgagaac
gacgacacgtccaagctgtctcgcgagcacgcggtcgccgtggcggctcctggcctggtg
gccatcgcgggcggcaagtacaccacgtatcgagtgatggcgtccgatgccgtagacatg
gcaagcgaattcgtgccggcacgggtggctccctccatcacggagaaggtgccactgctg
ggtgccgacggatacttcgcgctgatcaaccagaccgagcatgtgggggagacctacggt
ctgcatccctaccgcgtgcggcatctactggaccggtacggttcgttgatcggcgaggtg
cttgcctgtgcgggcacggaccatagcctgctgcaaccgattaccaaggcgcccatgtat
ttgaaggttgaggcgctctatgcggtggcggcagagggcgctctgcacctggaggacatt
ctggccaggcgcatgcgtatcgccatcgaatacccgcatcgcggtgtcgagtgtgcccag
gaagtcgccgagctggtggcacccgtgctggggtggtcggcagaggacatcgtgcgtgaa
gtggatacgtatcgggcgcgggtcgatgccgaagtgcgctcacagcgtcagcctgacgac
gcctcggcggacgcgctgcgagtggccgcgcccgaagcacggtcgttcattgtcgagccg
gtgaccgaaacaggtaccgtgctctcgcccgccaccaagtag

DBGET integrated database retrieval system