KEGG   Mycobacteroides abscessus DJO-44274: NF92_11805Help
Entry
NF92_11805        CDS       T03534                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mys  Mycobacteroides abscessus DJO-44274
Pathway
mys00630  Glyoxylate and dicarboxylate metabolism
mys01110  Biosynthesis of secondary metabolites
mys01130  Biosynthesis of antibiotics
mys01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mys00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NF92_11805 (katE)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    NF92_11805 (katE)
Enzymes [BR:mys01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     NF92_11805 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AIV16189
LinkDB All DBs
Position
2387965..2390073
Genome map
AA seq 702 aa AA seqDB search
MDHTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
ATKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQQDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQARMFWKSMSAIEAQHIVSAFSFELGKVSAESG
IRERVVVQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSSTRDSVATRRIA
VLAADGVDIHGVDLLRTALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGAGLDLLRAASVVETLATTAEIV
VDDGVVTTTAEASALPAEFVAAFVTAISRHRAWERETEMVPA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtggaccacacgtcgaatcccaaacaagagcaactcgacacgtctcgggtggaccgcgcc
tctggttatctcactacccagcaaggcgttcgcgtcgaccacaccgatgacgcgctcacc
gccggcgtcaggggccccacgttgctggaggatttccacgcgcgcgagaaagtcacgcat
tttgaccacgaacgaattccagagcgtgtggttcatgcgcgcggcgcgggcgcatacggc
tatttcgagccgtacgacgcgtggctatcggacttcacagccgcgaaatttctcaccaca
cccggcctgcgcacaccggtgttcgttcgtttctctaccgttgcgggctcccgcggctcg
gcagacaccgtgcgcgacgtacgtggatttgccacgaaattctatacacagcaaggaaat
tacgatctggtcggtaacaatttcccggtattcttcatccaggacggcatcaaattcccg
gacttcgtgcacgcggtgaagcctgagcccgacaacgagatcccgcaggccgcctcggcg
catgacaccttgtgggacttcgtggccgagcagcccgagacgctacacgcgatcatgtgg
ctcatgtccgatagggctctgccccgcagctaccgcatgatgcaagggttcggcgtacac
accttccgattggtcaacgacgccggcgagggcgtttttgtgaagttccactggaagccg
ctgctaggcgttcactcactgctgtgggacgaatgtcagcagatcgccggcaaggacccc
gatttcaaccggcgcgatctctgggacgcgatcgagtccggccagtttccggaatgggag
ctcggagtgcaactggtaccggaatccgacgagttcaaattccccttcgaccttcttgac
gcaacgaaaatcattccggaagaacaggttccggtgcagcctgtcggacgcatggtgctg
gatcgcaaccccgacaacttctttgccgagacagaacaggtcgcattccacacggccaat
gtggtgccgggaatcgacttcaccaacgacccgctgcttcagtttcgtaacttctcctac
ctggatacacaactgatccgcctaggcggcccgaacttcgcacaactgcccatcaacaga
ccgatcgccgaggtgcacaacaaccagcaagacggcttcgcgcagcatgacatcccacaa
ggcaagtcaagctatttcaagaacaccctcggcggcggctgcccggccctggcgcatgaa
gatgtcttccgccactacacccaacgagtggacgggcacaagatccgccagcgcgccgag
agcttcaaggatttctacagccaggcgcggatgttctggaagagtatgtccgccatcgag
gcgcagcacatcgtttcggcgttctcgttcgaactgggcaaggtgagtgccgagtccggg
attcgcgaacgtgtggtcgttcaactcaacctggtggaacacgatcttgcttcccaagtc
gccttgcagctgggcttacctgccccggcgccgcaatcggccgacgaggctcttccgccg
tccccggcgctgtcccagctctccagcacccgagacagcgtcgccacccgacggatcgcg
gtgctcgcagccgacggtgtcgacatccatggcgtggatctccttcgtacggcgctggaa
gagagcgacgcgattgtcgagatactcgcaccgactggcggcggaacgctcaccggcgaa
tccggcggcgaactccgcgtcgaccgcgcgatgaccaccatggcctcggtgttatacgac
gccgtggtcgtaccgtccggagccgaatccgcctggcggctggcgcgcaacggattcgcc
gtgcatttcgtttccgaggcctacaaacatctcaagcccgtcgcggcctacggtgccggg
ctcgatctgctccgggcagcctctgtggtggaaacactcgccaccaccgcagagattgtg
gttgacgacggcgtggtgacgaccaccgcggaagccagtgcattgccggccgaattcgtg
gccgcgtttgtcacggcgatcagccggcatcgcgcctgggaacgcgagaccgagatggtg
cccgcatag

DBGET integrated database retrieval system