KEGG   Mycobacterium sp. VKM Ac-1817D: G155_02880Help
Entry
G155_02880        CDS       T03634                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00250  Alanine, aspartate and glutamate metabolism
myv00280  Valine, leucine and isoleucine degradation
myv00310  Lysine degradation
myv00410  beta-Alanine metabolism
myv00640  Propanoate metabolism
myv00650  Butanoate metabolism
myv01100  Metabolic pathways
myv01120  Microbial metabolism in diverse environments
Module
myv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    G155_02880
   00650 Butanoate metabolism
    G155_02880
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    G155_02880
   00280 Valine, leucine and isoleucine degradation
    G155_02880
   00310 Lysine degradation
    G155_02880
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    G155_02880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myv01007]
    G155_02880
Enzymes [BR:myv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     G155_02880
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     G155_02880
    2.6.1.48  5-aminovalerate transaminase
     G155_02880
Amino acid related enzymes [BR:myv01007]
 Aminotransferase (transaminase)
  Class III
   G155_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIY44689
UniProt: A0A0A1FM06
LinkDB All DBs
Position
610612..611958
Genome map
AA seq 448 aa AA seqDB search
MTIAEITGAAIAQERRLVTAIPGPLSQEMQARKTAAVAGGVGTTLPVYVVAAGGGILVDA
DGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAAFTHTCFMVTPYEGYVRVAEELNRLTP
GDHEKRSVLFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKNG
FGPFAGEVYRVPTSFPFRDGETDGAAAAARALDLIDKQVGAENVAAVVIEPIQGEGGFIV
PAPGFLSALQDWCTEAGAVFVADEVQSGFARTGAMFAVEHDGVVPDLIVTAKGIAGGLPL
SAVTGRAEIMDAPHAGGLGGTYGGNPIACAAALAVIDTIEREGLLARAVEIEKTMIGRLS
AIAAEDSRIGEVRGRGAMIAVELVKAGTSVPDADLAKQVSAAAHAQGLVVLTCGTYGNVL
RFLPPLSMPDHLLVEGLDILAGIFAETR
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgccgagatcacgggtgcggccatcgctcaggaacgccggctcgtcaccgcc
attccgggcccgctctcgcaggagatgcaggcacggaaaaccgctgcggtggccggtgga
gtcgggaccaccctgcccgtctacgtggtggccgcaggcggcggaatcctcgtcgacgcc
gacggtaaccagctcatcgacttcggctccggcatcgccgtgaccaccgtgggcaacagc
gcgcccgccgtcgtggacgcggtcacccagcaggtcgccgcgttcacccacacctgcttc
atggtgacgccttacgagggctacgtgcgggttgccgaggagctcaaccggctcaccccg
ggtgaccatgagaagcgcagcgtgctgttcaactccggcgccgaagccgtcgagaacgct
gtgaagatcgcccgggcctacacccgcaggcaggccgtcgtcgtgttcgaccacgcctac
cacggccgcaccaacctgaccatggcgatgaccgccaagaaccagccgtataaaaacggg
ttcgggccgttcgccggtgaggtgtaccgcgtgcccacttcgttcccgttccgtgacggc
gagaccgacggagccgccgcggccgctcgcgccctcgacctgatcgacaagcaggtcggt
gccgaaaacgtggccgccgtggtgatcgagccgatccagggtgagggtggattcatcgtt
cccgcaccgggattcctgagcgcgctgcaggactggtgcaccgaggccggcgcggtcttc
gtcgccgacgaggtgcagtcgggcttcgcccgcaccggtgccatgttcgctgtcgagcat
gacggcgtcgtacccgatctgatcgtcaccgccaagggcatcgccggcggactgccgctg
tcggcggtcaccggccgcgccgagatcatggacgcaccgcatgccggcggcctcggtggt
acctacggcggtaacccgatcgcgtgtgcggctgcgctcgcagtcatcgacaccatcgag
cgcgagggcctgctcgcccgtgccgtggagatcgagaagaccatgatcggccggctcagc
gcgatcgcggctgaggattcccggatcggtgaggttcgcggccgtggcgccatgatcgcc
gtcgaactggtcaaggcgggcacgtccgtgcccgatgccgatctggccaagcaggtttcg
gcagccgcgcacgcccagggcctggtcgtcctgacctgcggcacctacggcaatgtgctg
cggttcctgccgccgctttcgatgcccgatcacctcctcgtggaggggctcgacatcctg
gccggcatcttcgccgagacccgctag

DBGET integrated database retrieval system