KEGG   Mycobacterium sp. VKM Ac-1817D: G155_03425Help
Entry
G155_03425        CDS       T03634                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
myv  Mycobacterium sp. VKM Ac-1817D
Pathway
myv00290  Valine, leucine and isoleucine biosynthesis
myv01100  Metabolic pathways
myv01110  Biosynthesis of secondary metabolites
myv01130  Biosynthesis of antibiotics
myv01210  2-Oxocarboxylic acid metabolism
myv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:myv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    G155_03425
   00290 Valine, leucine and isoleucine biosynthesis
    G155_03425
   00220 Arginine biosynthesis
    G155_03425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:myv01007]
    G155_03425
Enzymes [BR:myv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     G155_03425
    2.6.1.66  valine---pyruvate transaminase
     G155_03425
Amino acid related enzymes [BR:myv01007]
 Aminotransferase (transaminase)
  Class I
   G155_03425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AIY44779
UniProt: A0A0A1FMC7
LinkDB All DBs
Position
complement(734217..735488)
Genome map
AA seq 423 aa AA seqDB search
MVSVTTHQLPWQTGQHPKPRTFAQSTKLQDVLYEIRGPVHEQASRLEAEGHRILKLNIGN
PAPFGFEAPDVIMRDMIQALPYAQGYSDSKGIASARRAVFTRYELVEGFPKFDIEDVYLG
NGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGTPVHYMCDETQGWNPDVADI
ESKITERTKALVVINPNNPTGAVYSRETLEQMVELARKHQLLLLADEIYDKILYDDAKHI
SLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKEHATSFIEGISLLSNMRLCPNVP
AQHAIQVALGGHQSIDDLVLPGGRLLEQRDTAWTKLNEIPGVSCVKPAGALYAFPRLDPE
VHDIHDDEQLVLDLLLQEKILLTQGTGFNWPTPDHLRIVTLPWARDLAQAIERLGNFLAG
YRQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggtgagcgtgactacccatcagttgccgtggcagaccggtcagcacccgaagccgcgt
acgttcgcccagtccacgaagctgcaggacgtcctgtacgagatccgtggaccggtacac
gagcaggcctcacggctggaagctgaagggcaccgcatcctcaagctcaacatcggcaac
cccgcgccgttcggcttcgaggcgcccgacgtgatcatgcgcgacatgatccaggccctg
ccgtacgcacagggctattccgactccaagggcatcgccagcgcgcgccgcgcagtgttc
acccgctacgagctggtcgagggtttccccaagttcgacatcgaagacgtctacctgggc
aacggcgtctcagagctcatcacgatgaccctgcaggcgctgctcgacaacggcgatcag
gtgctcatcccggcgccggactaccccctgtggacggcgtcgaccgcgctggccggcggc
accccggtgcactacatgtgcgacgagacccagggctggaatcccgatgtcgccgacatc
gagtccaagatcaccgaacgcaccaaggcgctggtcgtgatcaacccgaacaaccccacc
ggcgcggtctacagccgcgaaactctggaacaaatggtggagttggcccgtaagcaccag
ctgttgctgttggccgacgagatctacgacaagatcctctacgacgacgccaagcacatc
tcgctggcgacattagcgcccgaccttctgtgcctgactttcaacgggctgtccaaggcc
taccgggtcgccggctaccgctcgggctggttggtcatcactggccccaaggaacacgcg
accagcttcatcgagggcatcagcctgctgtcgaatatgcggttgtgcccgaatgtgcct
gcgcagcacgcgattcaggtggccctgggcggccatcagagcatcgacgatctcgtgttg
ccgggtggccggctgctcgagcagcgtgacaccgcgtggaccaaactcaacgagatcccc
ggtgtctcgtgtgtgaaacccgcgggagcgctgtacgcgttcccgcgcctcgaccccgaa
gtgcacgacatccacgatgacgagcagctggtgctcgacctgctgttgcaggagaagatc
ctgttgacgcagggcacgggattcaactggcccacaccggatcacctgcgcatcgtcaca
ctgccgtgggcgcgcgacctggcccaggccatcgagcggctgggcaatttcctggccggc
taccggcagtaa

DBGET integrated database retrieval system